TROP-2 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The TROP-2 protein functions as a growth factor receptor and has been shown to play a critical role in mediating cellular responses associated with growth regulation. Its involvement indicates that it plays a crucial role in signal transduction during cell growth. TROP-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TROP-2 protein functions as a growth factor receptor and has been shown to play a critical role in mediating cellular responses associated with growth regulation. Its involvement indicates that it plays a crucial role in signal transduction during cell growth. TROP-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The TROP-2 protein appears to function as a growth factor receptor, suggesting a key role in mediating cellular responses associated with growth regulation. Its involvement in this capacity indicates that TROP-2 may play a crucial role in transducing signals that contribute to cellular growth processes. Further exploration of the specific signaling pathways and downstream effects mediated by TROP-2 as a growth factor receptor could provide valuable insights into its functional significance and potential implications in cellular development and homeostasis.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q8BGV3 (Q25-G270)
-
Molecular Construction
-
N-term
-
TROP-2 (Q25-G270)
Accession # Q8BGV3 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TACSTD2; Epithelial Glycoprotein-1; Prev. M1S1; Membrane Component, Chromosome 1, Surface Marker 1; GA733-1; Gastrointestinal Tumor-Associated Antigen GA7331; TROP2; Pancreatic Carcinoma Marker Protein GA7331; Tumor-Associated Calcium Signal Transducer 2;
-
AA Sequence
QSNCTCPTNKMTVCDTNGPGGVCQCRAMGSQVLVDCSTLTSKCLLLKARMSARKSGRSLVMPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFQERYKLHPSFLSAVHYEEPTIQIELRQNASQKGLRDVDIADAAYYFERDIKGESLFMGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTAG
-
Predicted Molecular Mass
28.8 kDa
-
Molecular Weight
Approximately 38-55 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
