TROP-2 Protein, Mouse (HEK293, hFc)
Based on 1 Customer Validation
The TROP-2 protein functions as a growth factor receptor and has been shown to play a critical role in mediating cellular responses associated with growth regulation. Its involvement indicates that it plays a crucial role in signal transduction during cell growth. TROP-2 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TROP-2 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TROP-2 protein functions as a growth factor receptor and has been shown to play a critical role in mediating cellular responses associated with growth regulation. Its involvement indicates that it plays a crucial role in signal transduction during cell growth. TROP-2 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TROP-2 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The TROP-2 protein appears to function as a growth factor receptor, suggesting a key role in mediating cellular responses associated with growth regulation. Its involvement in this capacity indicates that TROP-2 may play a crucial role in transducing signals that contribute to cellular growth processes. Further exploration of the specific signaling pathways and downstream effects mediated by TROP-2 as a growth factor receptor could provide valuable insights into its functional significance and potential implications in cellular development and homeostasis.
Verified Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104 cells/well are added to coated plates (40 μg/mL, 100 μL/well), ≥ 50% cells will adhere after 1 hour at 37°C.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q8BGV3 (Q25-G270)
-
Molecular Construction
-
N-term
-
TROP-2 (Q25-G270)
Accession # Q8BGV3 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TACSTD2; Epithelial Glycoprotein-1; Prev. M1S1; Membrane Component, Chromosome 1, Surface Marker 1; GA733-1; Gastrointestinal Tumor-Associated Antigen GA7331; TROP2; Pancreatic Carcinoma Marker Protein GA7331; Tumor-Associated Calcium Signal Transducer 2;
-
AA Sequence
QSNCTCPTNKMTVCDTNGPGGVCQCRAMGSQVLVDCSTLTSKCLLLKARMSARKSGRSLVMPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFQERYKLHPSFLSAVHYEEPTIQIELRQNASQKGLRDVDIADAAYYFERDIKGESLFMGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTAG
-
Predicted Molecular Mass
55 kDa
-
Molecular Weight
Approximately 66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
