UBE2R2 Protein, Human (His)
The UBE2R2 protein is a key element of the ubiquitin-proteasome system and functions as an E2 ubiquitin-conjugating enzyme. It accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to a variety of protein substrates. UBE2R2 Protein, Human (His) is the recombinant human-derived UBE2R2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The UBE2R2 protein is a key element of the ubiquitin-proteasome system and functions as an E2 ubiquitin-conjugating enzyme. It accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to a variety of protein substrates. UBE2R2 Protein, Human (His) is the recombinant human-derived UBE2R2 protein, expressed by E. coli , with N-6*His labeled tag.
Background
UBE2R2, an integral component of the ubiquitin-proteasome system, functions as an E2 ubiquitin-conjugating enzyme by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to diverse protein substrates. In in vitro assays, UBE2R2 demonstrates versatile catalytic activity, facilitating both monoubiquitination and 'Lys-48'-linked polyubiquitination reactions. This suggests its potential involvement in various cellular processes, including the targeted degradation of proteins, which may encompass the regulation of katenin or other relevant substrates.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q712K3 (M1-S238)
-
Molecular Construction
-
N-term
-
6*His
-
UBE2R2 (M1-S238)
Accession # Q712K3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2R2; Ubiquitin Conjugating Enzyme E2 R2; CDC34B; UBC3B; Ubiquitin-Conjugating Enzyme E2-CDC34B; Ubiquitin-Conjugating Enzyme E2 R2; E2 Ubiquitin-Conjugating Enzyme R2; Ubiquitin Carrier Protein R2; Ubiquitin-Protein Ligase R2; FLJ20419; MGC10481; Ubiqu
-
AA Sequence
MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
-
Predicted Molecular Mass
29.3 kDa
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)