1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Hydrolases (EC 3) Deubiquitinase
  4. Ubiquitin-Specific Protease
  5. Ubiquitin-Specific Peptidase 30
  6. USP30 Protein, Human (sf9, His)

USP30 protein is anchored on the outer mitochondrial membrane and severely inhibits mitophagy by antagonizing Parkin (PRKN). Hydrolyzing ubiquitin on RHOT1/MIRO1 and target proteins such as TOMM20 and USP30 blocks Parkin-mediated mitophagy, thereby regulating the clearance of damaged mitochondria. USP30 Protein, Human (sf9, His) is the recombinant human-derived USP30 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

USP30 protein is anchored on the outer mitochondrial membrane and severely inhibits mitophagy by antagonizing Parkin (PRKN). Hydrolyzing ubiquitin on RHOT1/MIRO1 and target proteins such as TOMM20 and USP30 blocks Parkin-mediated mitophagy, thereby regulating the clearance of damaged mitochondria. USP30 Protein, Human (sf9, His) is the recombinant human-derived USP30 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Background

USP30 Protein, anchored to the mitochondrial outer membrane, assumes a critical role as a deubiquitinating enzyme that acts as a key inhibitor of mitophagy, countering the actions of parkin (PRKN). By hydrolyzing ubiquitin attached by parkin on target proteins such as RHOT1/MIRO1 and TOMM20, USP30 impedes parkin's ability to drive mitophagy, thereby regulating the selective clearance of damaged mitochondria. Its substrate specificity extends to the preferential cleavage of 'Lys-6'- and 'Lys-11'-linked polyubiquitin chains, key linkages involved in mitophagic signaling. Notably, USP30 does not efficiently cleave polyubiquitin phosphorylated at 'Ser-65'. Beyond its role in mitophagy, USP30 also functions as a negative regulator of mitochondrial fusion, mediating the deubiquitination of MFN1 and MFN2. This dual role underscores the intricate regulatory mechanisms by which USP30 orchestrates mitochondrial dynamics and quality control, playing a central role in maintaining mitochondrial homeostasis.

Species

Human

Source

Sf9 insect cells

Tag

N-8*His

Accession

Q70CQ3 (T57-E517)

Gene ID

84749

Molecular Construction
N-term
8*His
USP30 (T57-E517)
Accession # Q70CQ3
C-term
Protein Length

Cytoplasmic Domain

Synonyms
USP30; Ubiquitin carboxyl-terminal hydrolase 30; Deubiquitinating enzyme 30; Ubiquitin thioesterase 30; Ubiquitin-specific-processing protease 30; Ub-specific protease 30
AA Sequence

TERKKRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTLLHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

USP30 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
USP30 Protein, Human (sf9, His)
Cat. No.:
HY-P701451
Quantity:
MCE Japan Authorized Agent: