USP30 Protein, Human (sf9, His)

USP30 protein is anchored on the outer mitochondrial membrane and severely inhibits mitophagy by antagonizing Parkin (PRKN). Hydrolyzing ubiquitin on RHOT1/MIRO1 and target proteins such as TOMM20 and USP30 blocks Parkin-mediated mitophagy, thereby regulating the clearance of damaged mitochondria. USP30 Protein, Human (sf9, His) is the recombinant human-derived USP30 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

USP30 protein is anchored on the outer mitochondrial membrane and severely inhibits mitophagy by antagonizing Parkin (PRKN). Hydrolyzing ubiquitin on RHOT1/MIRO1 and target proteins such as TOMM20 and USP30 blocks Parkin-mediated mitophagy, thereby regulating the clearance of damaged mitochondria. USP30 Protein, Human (sf9, His) is the recombinant human-derived USP30 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Background

USP30 Protein, anchored to the mitochondrial outer membrane, assumes a critical role as a deubiquitinating enzyme that acts as a key inhibitor of mitophagy, countering the actions of parkin (PRKN). By hydrolyzing ubiquitin attached by parkin on target proteins such as RHOT1/MIRO1 and TOMM20, USP30 impedes parkin's ability to drive mitophagy, thereby regulating the selective clearance of damaged mitochondria. Its substrate specificity extends to the preferential cleavage of 'Lys-6'- and 'Lys-11'-linked polyubiquitin chains, key linkages involved in mitophagic signaling. Notably, USP30 does not efficiently cleave polyubiquitin phosphorylated at 'Ser-65'. Beyond its role in mitophagy, USP30 also functions as a negative regulator of mitochondrial fusion, mediating the deubiquitination of MFN1 and MFN2. This dual role underscores the intricate regulatory mechanisms by which USP30 orchestrates mitochondrial dynamics and quality control, playing a central role in maintaining mitochondrial homeostasis.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • USP30 (T57-E517)
      Accession # Q70CQ3
    • C-term
  • Protein Length

    Cytoplasmic Domain

  • Synonyms

    USP30; Ubiquitin Specific Peptidase 30; Ubiquitin-Specific-Processing Protease 30; Ubiquitin Carboxyl-Terminal Hydrolase 30; Deubiquitinating Enzyme 30; Ubiquitin Thioesterase 30; Ub-Specific Protease 30; MGC10702; FLJ40511; Ubiquitin Carboxyl-Terminal Hy

  • AA Sequence

    TERKKRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTLLHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00