Scientific Reviews
Product Guides
Blogs
Topics
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!2025-02-06
126 Results for "
MIP
" in MedChemExpress (MCE) Product Catalog:
Products (126)
126 Results for "MIP" in MCE Product Catalog:
1
1 Cited Publications
Cat. No.: HY-P81143
Synonyms: CCR7_HUMAN; BLR 2; BLR2; C C chemokine receptor type 7; C C CKR 7; CC chemokine receptor 7; CC chemokine receptor type 7; CC CKR 7; CCCKR7; CCR 7; CD 197; CD197; CD197 antigen; CDW197; Chemokine C C motif receptor 7; Chemokine C C receptor 7; Chemokine receptor 7-like protein; EBI 1; EBI1; Ebi1h; EBV Induced G Protein Coupled Receptor 1; Epstein Barr virus induced G protein coupled receptor; Epstein Barr virus induced gene 1; EVI 1; EVI1; Lymphocyte Specific G Protein Coupled Peptide Receptor; MGC108519; MIP 3 beta receptor; MIP3 Beta Receptor.
1
1 Cited Publications
Cat. No.: HY-P7765
Purity: ≥ 95%, as determined by reducing SDS-PAGE.
Synonyms: CCL23; C-C Motif Chemokine 23; Prev. SCYA23; Small-Inducible Cytokine A23; MPIF-1; C6 Beta-Chemokine; MIP-3; CK-BETA-8; Ckb-8; CK-Beta-8; CKb8; Ckb-8-1; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 23; Hmrp-2a; Myeloid Progenitor Inhibitory Fact
Species:
Human
Source:
E. coli
Target:
Research Areas:
MIPS521 is a positive allosteric modulator of adenosine A1 receptor (A1AR). MIPS521 also has a lower A1R allosteric affinity (pKB=4.95; KB=11 μM). MIPS521 exhibits pain-relieving effects in vivo through modulation of the increased levels of endogenous adenosine .
Target:
Research Areas:
MIPS-21335 is a PI3KC2α inhibitor with an IC50 of 7 nM. MIPS-21335 also inhibits PI3KC2β, p110α, p110β and p110δ, with IC50 values of 43, 140, 386 and 742 nM, respectively. MIPS-21335 has antithrombotic effect. MIPS-21335 can be used for the researches of cardiovascular disease and metabolic disease, such as thrombosis and hyperlipidemia .
Cat. No.: HY-P5523A
Research Areas:
Cat. No.: HY-P4191A
Target:
Research Areas:
Cat. No.: HY-W014081
CAS No.: 1846-76-0
Synonyms: Ethyl 2-oxo-2H-chromene-3-carboxylate
Target:
Research Areas:
Ethyl 3-coumarincarboxylate is a coumarin derivative. Ethyl 3-coumarincarboxylate can be used as a pseudo-template to give a molecularly imprinted polymer (MIP) that has a fairly specific recognition capability for aflatoxins .
Cat. No.: HY-N10116A
CAS No.: 483-77-2
Category:
Cat. No.: HY-B1829AR
CAS No.: 2392-39-4
Synonyms: Dexamethasone 21-phosphate disodium (Standard)
Research Areas:
Neurological Disease Metabolic Disease Inflammation/Immunology
Dexamethasone phosphate (Dexamethasone 21-phosphate) disodium (Standard) is the analytical standard of Dexamethasone phosphate disodium (HY-B1829A). This product is intended for research and analytical applications. Dexamethasone phosphate (Dexamethasone 21-phosphate) disodium is a prodrug form of the glucocorticoid Dexamethasone (HY-14648). Dexamethasone phosphate disodium is produced by introducing a phosphate ester group at the 21-position of the Dexamethasone molecule, forming a salt with sodium ions, thereby significantly improving water solubility. Dexamethasone phosphate disodium inhibits LPS (HY-D1056)-induced degradation of IRAK-1 and IRAK-4, and blocks LPS-induced activation of TRAF6, p-TAK1 and p-JNK. Dexamethasone phosphate disodium inhibits the secretion of RANTES, TGF-β1 and NO, promotes the production of MIP-1α and IL-10, and blocks microglial migration. Dexamethasone phosphate disodium is almost completely converted to Dexamethasone in rat blood, and supports transdermal delivery via iontophoresis. Dexamethasone phosphate disodium can be used in research related to steroid-dependent ulcerative colitis, chemotherapy-induced vomiting, allergic asthma and acute colitis (inflammatory bowel disease).
Cat. No.: HY-129615
CAS No.: 949575-20-6
Research Areas:
MIP-1072 is a competitive prostate-specific membrane antigen (PSMA) inhibitor with a Ki value of 4.6 nM. MIP-1072 specifically binds to PSMA and is internalized into PSMA-expressing prostate cancer cells. MIP-1072 accumulates in PSMA-expressing prostate cancer xenografts. MIP-1072 specifically blocks the uptake of 68Ga-NOTA-GUL by PSMA-positive prostate cancer xenografts. When radiolabeled with 123I, MIP-1072 functions as a SPECT/CT molecular imaging agent. MIP-1072 can be used in prostate cancer-related research .
Cat. No.: HY-123733
CAS No.: 949575-22-8
Synonyms: RPS-001
Research Areas:
MIP-1095 (RPS-001) is a PSMA inhibitor with a Ki value of 0.24 nM. MIP-1095 binds to PSMA with high affinity and can be internalized into PSMA-expressing cancer cells. When radiolabeled with 123I, 124I or 131I, MIP-1095 enables SPECT/CT imaging, PET/CT imaging or targeted radiation delivery, respectively. 131I-MIP-1095 can alter serum PSA levels and relieve bone pain. MIP-1095 can be used in research related to metastatic castration-resistant prostate cancer .
Cat. No.: HY-123733A
Purity: 99.76%
Synonyms: RPS-001 TFA
Research Areas:
MIP-1095 TFA (RPS-001 TFA) is a PSMA inhibitor with a Ki value of 0.24 nM. MIP-1095 TFA binds to PSMA with high affinity and can be internalized into PSMA-expressing cancer cells. When radiolabeled with 123I, 124I or 131I, MIP-1095 TFA enables SPECT/CT imaging, PET/CT imaging or targeted radiation delivery, respectively. 131I-MIP-1095 TFA can alter serum PSA levels and relieve bone pain. MIP-1095 TFA can be used in research related to metastatic castration-resistant prostate cancer .
Cat. No.: HY-120265
CAS No.: 1416956-33-6
Target:
Research Areas:
MIPS-9922 is a potent and selective PI3Kβ inhibitor with an IC50 of 63 nM. MIPS-9922 inhibits PI3Kβ with >30-fold higher potency than PI3Kδ. MIPS-9922 blocks PI3K mediated activation of platelet glycoprotein αIIbβ3 activation and platelet adhesion in vitro. MIPS-9922 shows anti-platelet and anti-thrombotic activities .
Cat. No.: HY-P5523
CAS No.: 592520-07-5
Research Areas:
Cat. No.: HY-P4191
CAS No.: 1883816-50-9
Synonyms: MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
Target:
Research Areas:
Cat. No.: HY-179277
Target:
Research Areas:
MIPS3526 is a potent and selective A2B adenosine receptor (A2BR) agonist with a pEC50 of 10.17 (EC50 of 58 pM). MIPS3526 shows highly receptor subtype selective versus the A1R, A2AR, and A3R. MIPS3526 ameliorates angiotensin II stimulating effects in both cardiac myocytes and fibroblasts. MIPS3526 can be used for the study of cardiovascular disease including heart failure where cardiac remodeling is a major driver .
Cat. No.: HY-149650
CAS No.: 2374139-51-0
Target:
Research Areas:
TLR4 agonist-1 (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells .
Cat. No.: HY-149650A
CAS No.: 3020639-70-4
Target:
Research Areas:
TLR4 agonist-1 (TEA) (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells .
Cat. No.: HY-B0155
CAS No.: 306296-47-9
Synonyms: SCH 417690; SCH-D; MK-7690 free base
Vicriviroc (SCH 417690) is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
Cat. No.: HY-P11093
Target:
Antibiotic Bacterial Fungal Apoptosis Reactive Oxygen Species (ROS) TNF Receptor NO Synthase Interleukin Related NF-κB Toll-like Receptor (TLR)
Research Areas:
-
-
Protocols
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!A suitable model is crucial in drug screening experiments. Organs can mimic the three-dimensional functional structure of internal organs, have similar spatial organization to corresponding organs, maintain some key characteristics, and reproduce some physiological functions. They are widely used for modeling and personalized drug screening physiological functions.2025-02-06
