2. Search Result
Search Result
Results for "

CCR5 inhibitor

" in MedChemExpress (MCE) Product Catalog:

36

Inhibitors & Agonists

4

Peptides

3

Inhibitory Antibodies

2

Natural
Products

Targets Recommended:
Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-14882
    Cenicriviroc
    5+ Cited Publications

    TAK-652; TBR-652

    		 CCR HIV Infection Endocrinology
    Cenicriviroc (TAK-652) is an orally active, dual CCR2/CCR5 antagonist, also inhibits both HIV-1 and HIV-2, and displays potent anti-inflammatory and antiinfective activity .
    Cenicriviroc
  • HY-13406
    TAK-779
    Maximum Cited Publications
    11 Publications Verification

    Takeda 779

    		 CCR HIV CXCR Infection Inflammation/Immunology Endocrinology
    TAK-779 is a potent and selective nonpeptide antagonist of CCR5 and CXCR3, with a Ki of 1.1 nM for CCR5, and effectively and selectively inhibits R5 HIV-1, with EC50 and EC90 of 1.2 nM and 5.7 nM, respectively, in MAGI-CCR5 cells.
    TAK-779
  • HY-P1034
    DAPTA
    4 Publications Verification

    D-Ala-peptide T-amide; Adaptavir

    		 CCR HIV Infection Endocrinology
    DAPTA is a synthetic peptide, functions as a viral entry inhibitor by targeting selectively CCR5, and shows potent anti-HIV activities.
    DAPTA
  • HY-14882A
    Cenicriviroc Mesylate
    5+ Cited Publications

    TAK-652 Mesylate; TBR-652 Mesylate

    		 CCR HIV Infection Inflammation/Immunology Endocrinology
    Cenicriviroc Mesylate (TAK-652 Mesylate) is a dual CCR2/CCR5 antagonist, also inhibits both HIV-1 and HIV-2, and displays potent anti-inflammatory and antiinfective activity.
    Cenicriviroc Mesylate
  • HY-P99697
    Leronlimab

    PRO 140

    		 CCR HIV Infection Cancer
    Leronlimab (PRO 140) is a humanized IgG4 anti-CCR5 monoclonal antibody. Leronlimab inhibits CCR5-mediated HIV-1 viral and lung metastasis in mouse tumor models. Leronlimab can be used for the research of HIV nonalcoholic steatohepatitis (NASH) and cancer .
    Leronlimab
  • HY-15971A
    AMD 3465
    5 Publications Verification

    GENZ-644494

    		 CXCR HIV Infection Endocrinology
    AMD 3465 (GENZ-644494) is a potent antagonist of CXCR4, inhibits binding of 12G5 mAb and CXCL12 AF647 to CXCR4, with IC50s of 0.75 nM and 18 nM in SupT1 cells; AMD 3465 also potently inhibits the replication of X4 HIV strains (IC50: 1-10 nM), but has no effect on CCR5-using (R5) viruses.
    AMD 3465
  • HY-17377
    Vicriviroc maleate

    SCH-417690 maleate; SCH-D maleate

    		 CCR HIV Infection Endocrinology Cancer
    Vicriviroc maleate (SCH-417690 maleate; SCH-D maleate) is a potent, selective, oral bioavailable and CNS penetrated antagonist of CCR5, with a Ki of 2.5 nM, and also inhibits HIV-1 in PBMC cells, with IC90s of 3.3 nM (JrFL), 2.8 nM (ADA-M), 1.8 nM (301657), 4.9 nM (JV1083) and 10 nM (RU 570).
    Vicriviroc maleate
  • HY-D0976
    NF279
    1 Publications Verification

    		 P2X Receptor HIV NTPDase CXCR Infection
    NF279 is a selective P2X1 receptor antagonist and NTPDase inhibitor, with a P2X1 IC50 value of 19 nM. NF279 suppresses GABA-evoked currents, reduces ATP-excited respiratory activity, alters hypoglossal nerve burst parameters, and blocks CXCR4, CCR5, CXCR3, and CXCR7-mediated calcium responses. NF279 arrests HIV-1 fusion downstream of CD4 binding, inhibits R5- and X4-tropic HIV-1 strains. NF279 can be used for the research of HIV-1 infection .
    NF279
  • HY-15971
    AMD 3465 hexahydrobromide
    5 Publications Verification

    GENZ-644494 hexahydrobromide

    		 CXCR HIV Infection Endocrinology
    AMD 3465 hexahydrobromide (GENZ-644494 hexahydrobromide) is a potent antagonist of CXCR4, inhibits binding of 12G5 mAb and CXCL12 AF647 to CXCR4, with IC50s of 0.75 nM and 18 nM in SupT1 cells; AMD 3465 also potently inhibits the replication of X4 HIV strains (IC50: 1-10 nM), but has no effect on CCR5-using (R5) viruses.
    AMD 3465 hexahydrobromide
  • HY-19974
    TAK-220
    3 Publications Verification

    		 CCR HIV Infection Endocrinology
    TAK-220 is a selective and orally bioavailable CCR5 antagonist, with IC50s of 3.5 nM and 1.4 nM for inhibition on the binding of RANTES and MIP-1α to CCR5, respectively, but shows no effect on the binding to CCR1, CCR2b, CCR3, CCR4, or CCR7; TAK-220 also selectively inhibits HIV-1, with EC50s of 1.2 nM (HIV-1 KK), 0.72 nM (HIV-1 CTV), 1.7 nM (HIV-1 HKW), 1.7 nM (HIV-1 HNK), 0.93 nM (HIV-1 HTN), and 0.55 nM (HIV-1 HHA), and EC90s of 12 nM (HIV-1 KK), 5 nM (HIV-1 CTV), 12 nM (HIV-1 HKW), 28 nM (HIV-1 HNK), 15 nM (HIV-1 HTN), and 4 nM (HIV-1 HHA) in PBMCs.
    TAK-220
  • HY-P4191A
    Met-RANTES (human) acetate

    		CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) acetate
  • HY-107401
    Ancriviroc

    SCH-351125

    		 HIV CCR Calcium Channel Infection
    Ancriviroc (SCH-351125) is an orally active CCR5 antagonist with an IC50 value of 13 nM against hCCR5. Ancriviroc specifically binds to hCCR5, blocks ligand-induced signal transduction, calcium influx, GTPγS binding, chemotaxis, ligand binding, and HIV-1 entry, induces conformational changes in CCR5, and inhibits infection and replication of R5-tropic HIV-1 .
    Ancriviroc
  • HY-119101
    AZD-5672
    1 Publications Verification

    		 CCR Potassium Channel P-glycoprotein Inflammation/Immunology
    AZD-5672 is an orally active, potent, and selective CCR5 antagonist (IC50=0.32 nM). AZD-5672 shows moderate activity against the hERG ion channel (binding IC50=7.3 μM). AZD5672 is a substrate of human P-gp, and inhibits P-gp-mediated digoxin transport (IC50=32 μM). AZD-5672 can be used for the research of rheumatoid arthritis .
    AZD-5672
  • HY-134851
    HIV-1 inhibitor-6
    1 Publications Verification

    		 HIV Infection
    HIV-1 inhibitor-6 (compound 9), a diheteroarylamide-based compound, is a potent HIV-1 pre-mRNA alternative splicing inhibitor. HIV-1 inhibitor-6 blocks HIV replication. HIV-1 inhibitor-6 is active against wild-type HIV-1IIIB (subtype B, X4-tropic) and HIV-1 97USSN54 (subtype A, R5-tropic) with EC50s of 0.6 μM and 0.9 μM, respectively. HIV-1 inhibitor-6 inhibits HIV strains resistant to agents targeting HIV reverse transcriptase, protease, integrase, and coreceptor CCR5 with EC50s ranging from 0.9 to 1.5 μM .
    HIV-1 inhibitor-6
  • HY-111321
    Fuscin

    		Oxidative Phosphorylation CCR HIV Bacterial Mitochondrial Metabolism Endogenous Metabolite Infection Metabolic Disease
    Fuscin, a fungal metabolite, CCR5 receptor antagonist with anti-HIV effects. Fuscin is a respiration and oxidative phosphorylation inhibitor, and also a mitochondrial SH-dependent transport-linked functions inhibitor .
    Fuscin
  • HY-100261
    CCR5 antagonist 1

    		CCR HIV Infection Endocrinology
    CCR5 antagonist 1 is a CCR5 antagonist which can inhibit HIV replication extracted from WO 2004054974 A2.
    CCR5 antagonist 1
  • HY-162512
    CB-0821

    		CCR HIV Infection
    CB-0821 is a high affinity CCR5 inhibitor with a Ki of 0.04 nM. CB-0821 binds efficiently to the hydrophobic pocket of the CCR5 protein, to inhibit the interactions between viral protein and CCR5, thereby inhibiting viral entry. CB-0821 has the potential for anti-HIV research .
    CB-0821
  • HY-P991541
    HGS101

    		CCR HIV Infection
    HGS101 is a fully human CCR5 monoclonal antibody with high affinity to CCR5. HGS101 binds to the 2nd extracellular loop (ECL-2) and acts as a signal antagonist. HGS101 restores Maraviroc (HY-13004) inhibition of Maraviroc-resistant HIV-1 infection of PBMCs. HGS101 shows anti-HIV activity by inhibiting CCR5 signaling in simian immunodeficiency virus-uninfected RMs models .
    HGS101
  • HY-P991653
    HGS004

    		CCR HIV Infection
    HGS004 is a humanized IgG4 monoclonal antibody inhibitor targeting CCR5. HGS004 has potent antivival activity against a diverse panel of CCR5-tropic HIV-1 and durg (such as Maraviroc (HY-13004))-resistant strains. HGS004 can be used for HIV-1 infections research .
    HGS004
  • HY-124848
    CMPD167

    MRK-1

    		 CCR HIV Infection
    CMPD167 (MRK-1) is an orally active CCR5 inhibitor with potent antiviral activity in vitro .
    CMPD167
  • HY-15571A
    VCH-286

    		HIV CCR Infection
    VCH-286 is a CCR5 inhibitor that exhibits potent in vitro anti-HIV-1 activity when used alone .
    VCH-286
  • HY-14882R
    Cenicriviroc (Standard)

    TAK-652 (Standard); TBR-652 (Standard)

    		 CCR HIV Reference Standards Infection Endocrinology
    Cenicriviroc (Standard) is the analytical standard of Cenicriviroc. This product is intended for research and analytical applications. Cenicriviroc (TAK-652) is an orally active, dual CCR2/CCR5 antagonist, also inhibits both HIV-1 and HIV-2, and displays potent anti-inflammatory and antiinfective activity .
    Cenicriviroc (Standard)
  • HY-123902
    Ophiobolin C

    Zizanin A

    		 CCR HIV Infection
    Ophiobolin C inhibits CCR5 binding to the envelop protein gp120 and CD4, which is responsible for mediating the entry of HIV-1 into cells . Ophiobolin C is also cytotoxic to chronic lymphocytic leukemia cells .
    Ophiobolin C
  • HY-P4191
    Met-RANTES (human)

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    		 CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-15971AR
    AMD 3465 (Standard)

    GENZ-644494 (Standard)

    		 CXCR HIV Reference Standards Infection Endocrinology
    AMD 3465 (Standard) is the analytical standard of AMD 3465. This product is intended for research and analytical applications. AMD 3465 (GENZ-644494) is a potent antagonist of CXCR4, inhibits binding of 12G5 mAb and CXCL12AF647 to CXCR4, with IC50s of 0.75 nM and 18 nM in SupT1 cells; AMD 3465 also potently inhibits the replication of X4 HIV strains (IC50: 1-10 nM), but has no effect on CCR5-using (R5) viruses.
    AMD 3465 (Standard)
  • HY-15971R
    AMD 3465 hexahydrobromide (Standard)

    GENZ-644494 hexahydrobromide (Standard)

    		 CXCR HIV Reference Standards Infection Endocrinology
    AMD 3465 (hexahydrobromide) (Standard) is the analytical standard of AMD 3465 (hexahydrobromide). This product is intended for research and analytical applications. AMD 3465 hexahydrobromide (GENZ-644494 hexahydrobromide) is a potent antagonist of CXCR4, inhibits binding of 12G5 mAb and CXCL12AF647 to CXCR4, with IC50s of 0.75 nM and 18 nM in SupT1 cells; AMD 3465 also potently inhibits the replication of X4 HIV strains (IC50: 1-10 nM), but has no effect on CCR5-using (R5) viruses.
    AMD 3465 hexahydrobromide (Standard)
  • HY-B0155
    Vicriviroc

    SCH 417690; SCH-D; MK-7690 free base

    		 CCR HIV Infection Cancer
    Vicriviroc (SCH 417690) is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
    Vicriviroc
  • HY-173516
    CCR5-IN-1

    		CCR Infection Cardiovascular Disease Neurological Disease Inflammation/Immunology
    CCR5-IN-1 (compound 3ad) is a selective allosteric CCR5 inhibitor with an IC50 of 1.09 μM. CCR5-IN-1 can be used in the study of cardiovascular, central nervous system, immune system, and infectious diseases .
    CCR5-IN-1
  • HY-118962
    E913

    		CCR HIV Infection
    E913 is a CCR5 antagonist that competes with the binding of antibodies to CCR5 which recognize the C-terminal half of the second extracellular loop (ECL2B) of CCR5. E913 can specifically block the binding of macrophage inflammatory protein-1alpha (MIP-1alpha) to CCR5 (IC50 = 0.002 μM) and MIP-1alpha-elicited cellular Ca 2+ mobilization (IC50 = 0.02 μM). E913 inhibits the replication of laboratory and primary R5 HIV-1 strains as well as various multidrug-resistant monocyte/macrophage tropic (R5) HIV-1 (IC50 = 0.03-0.06 μM). E913 can be used for the research of infection, such as HIV-1 infection .
    E913
  • HY-123884
    GSK-214096

    		CCR HIV Infection
    GSK-214096 is a selective CCR5 antagonist and an inhibitor of HIV-1 entry. GSK-214096 inhibits HIV-1 glycoprotein 120 (gp120) .
    GSK-214096
  • HY-123768
    SCH 350581

    AD-101

    		 CCR Infection
    SCH 350581 (AD-101) is a CCR5 antagonist. SCH 350581 inhibits HIV-1 replication, viral entry into cells, and the binding of gp120 to cell lines in primary lymphocytes .
    SCH 350581
  • HY-P10801
    mC46 peptide

    C46 peptide

    		 HIV Infection
    mC46 (C46) peptide is a membrane-associated fusion peptide inhibitor. mC46 peptide potently inhibits HIV-1 replication and entry. mC46 also inhibits CCR5-tropic, CXCR4-tropic, and dual-tropic HIVs, SIV, and SHIV .
    mC46 peptide
  • HY-146338
    RPR103611

    		HIV Infection
    RPR103611, the betulinic acid derivative, is a potent HIV-1 entry inhibitor with IC50s of 80, 0.27, and 0.17 for CCR5-tropic virus YU2, CXCR4-tropic virus NL4-3 and dual tropic virus 89.6, respectively .
    RPR103611
  • HY-B0155B
    Vicriviroc malate

    SCH 417690 malate; SCH-D malate; MK-7690

    		 CCR HIV Infection Cancer
    Vicriviroc (SCH 417690) malate is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc malate can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
    Vicriviroc malate
  • HY-N11723
    Catenarin

    Katenarin

    		 CCR CXCR p38 MAPK JNK Calcium Channel Infection Metabolic Disease Inflammation/Immunology
    Catenarin, an anthraquinone compound, inhibits CCR5- and CXCR4-mediated chemotaxis. Catenarin reduces the phosphorylation of mitogen-activated protein kinases (p38 and JNK) and their upstream kinases (MKK6 and MKK7), and calcium mobilization. Catenarin shows anti-inflammatory effect and suppresses leukocyte migration in the diabetes. Catenarin exhibits significant inhibitory effects against Gram-positive bacteria. Catenarin prevents type 1 diabetes (T1D) in nonobese diabetic mice [1][2].
    Catenarin
  • HY-164630
    CCR5/CXCR3-IN-1

    		CCR CXCR Inflammation/Immunology
    CCR5/CXCR3-IN-1 (compound 1) is a CXCR3 and CCR5 inhibitor. CCR5/CXCR3-IN-1 inhibits chemotaxis of CXCR3 and CCR5-expressing transformed cells, and does not inhibits the chemotaxis of transfected cells expressing CXCR4. CCR5/CXCR3-IN-1 can be used for the study of chronic arthritic rheumatism .
    CCR5/CXCR3-IN-1

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: