1. Peptides
  2. Calcitonin, eel TFA

Calcitonin, eel TFA (Synonyms: Thyrocalcitonin eel (TFA))

Cat. No.: HY-P1463A Purity: 98.79%
Handling Instructions

Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Calcitonin, eel TFA Chemical Structure

Calcitonin, eel TFA Chemical Structure

Size Price Stock Quantity
1 mg USD 180 In-stock
Estimated Time of Arrival: December 31
5 mg USD 540 In-stock
Estimated Time of Arrival: December 31
10 mg USD 910 In-stock
Estimated Time of Arrival: December 31
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Other Forms of Calcitonin, eel TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Information

  • Purity & Documentation

  • References

Description

Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis[1].

In Vitro

Calcitonin, eel effectively induces a concentration-dependent stimulation of phosphoinositide hydrolysis and stimulates prolactin release compared to salmon calcitonin in cultured anterior pituitary cells[1].
Calcitonin, eel is inactive on the inhibition of prolactin release under thyrotropin releasing hormone (TRH) stimulated conditions[1].

References
Molecular Weight

3528.89

Formula

C₁₄₈H₂₄₂F₃N₄₃O₄₉S₂

Sequence

Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)

Sequence Shortening

CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7)

Storage
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calcitonin, eel TFA
Cat. No.:
HY-P1463A
Quantity:

Calcitonin, eel TFA

Cat. No.: HY-P1463A