iGluR
Ionotropic glutamate receptors
iGluR (ionotropic glutamate receptor) is a ligand-gated ion channel that is activated by the neurotransmitter glutamate. iGluR are integral membrane proteins compose of four large subunits that form a central ion channel pore. Sequence similarity among all known glutamate receptor subunits, including the AMPA, kainate, NMDA, and δ receptors.
AMPA receptors are the main charge carriers during basal transmission, permitting influx of sodium ions to depolarise the postsynaptic membrane. NMDA receptors are blocked by magnesium ions and therefore only permit ion flux following prior depolarisation. This enables them to act as coincidence detectors for synaptic plasticity. Calcium influx through NMDA receptors leads to persistent modifications in the strength of synaptic transmission.
iGluR Isoform Specific Products
All Product Categories
-
iGluR Inhibitors
(131)
View all products
-
iGluR Agonists
(128)
View all products
-
iGluR Antagonists
(347)
View all products
-
iGluR Activators
(35)
View all products
-
iGluR Modulators
(94)
View all products
-
iGluR MDM2 Inhibitor
(1)
View all products
-
iGluR Controls
(6)
View all products
-
iGluR Ligands
(3)
View all products
-
iGluR Related Products (828)
Related Products (828)
-
Antibodies (11)
-
iGluR Isoform Comparison
-
Eliprodil (Standard)
0 ImagesSynonyms: SL-820715 (Standard)Eliprodil (Standard) is the analytical standard of Eliprodil. This product is intended for research and analytical applications. 0 -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
L-Aspartic acid-13C-2
0 ImagesCat. No.: HY-W015824S6CAS No.: 81201-98-1L-Aspartic acid-13C-2 is the 13C-labeled L-Aspartic acid (HY-N0666). L-Aspartic acid is a NMDA receptor agonist and acidic amino acid. L-Aspartic acid has no independent analgesic activity. L-Aspartic acid can antagonize the analgesic effects of D-Aspartic acid and Morphine. L-Aspartic acid regulates polymorph transformation, crystal growth/aggregation and nucleation processes of calcium carbonate, and can serve as a biomineralization template. L-Aspartic acid promotes burst firing of central neurons. L-Aspartic acid can be used in studies related to cerebral ischemia and epilepsy. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Ifenprodil tartrate (Standard)
0 ImagesSynonyms: NP-120 tartrate (Standard); RC-61-91 tartrate (Standard)Ifenprodil (tartrate) (Standard) is the analytical standard of Ifenprodil (tartrate). This product is intended for research and analytical applications. Ifenprodil tartrate is a typical noncompetitive NMDA receptor antagonist. Ifenprodil tartrate exerts high affinity at NR1A/NR2B receptors (IC50=0.34 μM) over 400-fold than at NR1A/NR2A receptors (IC50=146 μM). Ifenprodil tartrate inhibits GIRK (Kir3), reduces inward currents through the basal GIRK activity. Ifenprodil tartrate has the potential to be a cerebral vasodilator. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
IC87201 (Standard)
0 ImagesCat. No.: HY-100457RCAS No.: 866927-10-8 -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
UBP296
0 ImagesCat. No.: HY-107605CAS No.: 745055-86-1UBP296 is a potent and selective antagonist of GLUK5-containing kainate receptor in the spinal cord. UBP296 reversibly blocks ATPA-induced depressions of synaptic transmission, and affects AMPA receptor-mediated synaptic transmission directly in rat hippocampal slices. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
0 ImagesCat. No.: HY-P3431CAS No.: 2279952-25-7VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
15-Methoxypinusolidic acid
0 ImagesCat. No.: HY-N1593CAS No.: 769928-72-515-Methoxypinusolidic acid (compound 1) is a labdane diterpene compound isolated from the leaves of Calocedrus microlepic. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
0 ImagesCat. No.: HY-P3431AVSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
Your Search Returned No Results.
Sorry. There is currently no product that acts on isoform Bcl-2, Bcl-W and Bim together.Please
try each isoform separately.