GHRF, mouse TFA
Based on 1 Customer Validation
GHRF, mouse TFA, a mouse growth hormone-releasing factor, is a peptide containing 44 amino acids. GHRF, mouse TFA stimulates the release and synthesis of growth hormone.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 98.87%
- Formel: C220H365N69O64S.xC2HF3O2
- Molecular Weight:5032.74 (free base)
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biologische Aktivität
Chemical Information
-
Appearance Solid
-
Molecular Weight 5032.74 (free base)
-
Formel C220H365N69O64S.xC2HF3O2
-
Color White to off-white
-
Synonyms
Mouse growth hormone-releasing factor TFA
-
Sequence
His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser
-
Sequence Shortening
HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Lösungsmittel & Löslichkeit
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Reinheit & Dokumentation
-
Data Sheet (282 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)