Maurotoxin
Maurotoxin is a 34-residue and four disulde-bridged toxin that can be isolated from the chactoid scorpion (Scorpio maurus). Maurotoxin inhibits the Shaker potassium channels (ShB) K+ current with an IC50 of 2 nM.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 188240-41-7
- Formel: C145H232N46O46S8
- Molecular Weight:3612.19
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Biologische Aktivität
Chemical Information
-
CAS. Nr. 188240-41-7
-
Molecular Weight 3612.19
-
Formel C145H232N46O46S8
-
Sequence
Val-Ser-Cys-Thr-Gly-Ser-Lys-Asp-Cys-Tyr-Ala-Pro-Cys-Arg-Lys-Gln-Thr-Gly-Cys-Pro-Asn-Ala-Lys-Cys-Ile-Asn-Lys-Ser-Cys-Lys-Cys-Tyr-Gly-Cys-NH2 (Disulfide bridge: Cys3-Cys24, Cys9-Cys29, Cys13-Cys19, Cys31 -Cys34)
-
Sequence Shortening
VSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC-NH2 (Disulfide bridge: Cys3-Cys24, Cys9-Cys29, Cys13-Cys19, Cys31 -Cys34)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
Verweise
[1]. Bende NS, et al. A distinct sodium channel voltage-sensor locus determines insect selectivity of the spider toxin Dc1a. Nat Commun. 2014 Jul 11;5:4350. [Content Brief]
[2]. Castle NA, et al. Maurotoxin: a potent inhibitor of intermediate conductance Ca2+-activated potassium channels. Mol Pharmacol. 2003 Feb;63(2):409-18. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Maurotoxin Related Classifications
HY-P5165 Related Classifications
Powered by Bioz