country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5603

Copy Link Print Information

Bovine neutrophil beta-defensin 12

Name: Bovine neutrophil beta-defensin 12
Brand: MedChemExpress
SKU: HY-P5603
Availability: PreOrder

(Synonyms: BNBD-12)

Bovine neutrophil beta-defensin 12 is an antimicrobial peptide derived from bovine neutrophils, which has antibacterial activity against Escherichia coli and Staphylococcus aureus.

For research use only. We do not sell to patients.

CAS No.: 455257-02-0
Formula: C₁₇₄H₂₈₁N₅₇O₄₄S₇
Molecular Weight:4099.90

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Bovine neutrophil beta-defensin 12 Chemical Structure

CAS No.: 455257-02-0

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

Bovine neutrophil beta-defensin 12 is an antimicrobial peptide derived from bovine neutrophils, which has antibacterial activity against Escherichia coli and Staphylococcus aureus^[1].

Chemical Information

CAS No. 455257-02-0
Molecular Weight 4099.90
Formula C₁₇₄H₂₈₁N₅₇O₄₄S₇
Synonyms

BNBD-12
Sequence

Gly-Pro-Leu-Ser-Cys-Gly-Arg-Asn-Gly-Gly-Val-Cys-Ile-Pro-Ile-Arg-Cys-Pro-Val-Pro-Met-Arg-Gln-Ile-Gly-Thr-Cys-Phe-Gly-Arg-Pro-Val-Lys-Cys-Cys-Arg-Ser-Trp (Disulfide bridge:Cys5-Cys34;Cys12-Cys27;Cys17-Cys35)
Sequence Shortening

GPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW (Disulfide bridge:Cys5-Cys34;Cys12-Cys27;Cys17-Cys35)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (259 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Zimmermann GR, et al. Solution structure of bovine neutrophil beta-defensin-12: the peptide fold of the beta-defensins is identical to that of the classical defensins. Biochemistry. 1995 Oct 17;34(41):13663-71. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote