GLP-1(7-37)
Based on 10 publication(s) in Google Scholar
GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Pureté : 99.70%
- CAS No.: 106612-94-6
- Formule: C151H228N40O47
- Masse moléculaire:3355.67
-
Stockage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications Citing Use of MedChemExpress (MCE) GLP-1(7-37)
More- J Med Chem. 2026 Feb 26;69(4):4984-5001. [Abstract]
- ACS Med Chem Lett. 2026 May 4;17(5):963-972. [Abstract]
- Pharmaceutical Fronts. 2025; 07(02): e126-e136
- Patent. US12233112.
- Patent. US12233110.
- Patent. US12233111.
- Patent. US20230278991A1.
- Patent. US20230257369A1.
- Patent. US20200283424A1.
- Patent. US20200283424A1.
-
Bio/Physico-chemical Assay
Activité biologique
Description
In Vivo
Infusion of GLP-1(7-37) (5 pmol/min/kg) from 1 hour through 7 hours produces a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle in rats with maintained glucose concentration at 11 mM[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male Sprague-Dawley rats weighing 300 to 350 g with maintained plasma glucose concentration at 11 mM[2].
-
Dosage:0.5, 5 or 50 pmol/min/kg.
-
Administration:IV during the second hour of a 2-hour 11-mmol/L hyperglycemic clamp.
-
Result:Produced a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion.
-
Animal Model:Male Sprague-Dawley rats weighing 300 to 350 g with glucose IV at a variable rate for 7 hours to maintain plasma glucose concentration at 11 mM[2].
-
Dosage:5 pmol/min/kg.
-
Administration:IV from 1 hour through 7 hours[2].
-
Result:Produced a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle.
Chemical Information
-
CAS No. 106612-94-6
-
Appearance Solid
-
Masse moléculaire 3355.67
-
Formule C151H228N40O47
-
Color White to off-white
-
Sequence
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
-
Sequence Shortening
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (10)
-
Journal Impact Factor
-
Most Recent
-
J Med Chem
Discovery and Preclinical Evaluation of TPM003: A Novel GLP-1/GIP/Glucagon Triple Hormone Receptor Agonist with Robust Efficacy in Obesity and NASH. [Abstract]2026 Feb 26;69(4):4984-5001. PMID: 41640214
GLP-1(7-37) purchased from MedChemExpress. Usage Cited in: J Med Chem. 2026 Feb 26;69(4):4984-5001. [Abstract]
Concentration response curves of the hit peptides in receptor activation at human GLP-1R, compared with RETA. Human GLP-1(7–37), GIP, and glucagon were selected as positive controls toward their corresponding receptors and generally referred to as NL (native ligands) toward each receptor activation assay.
-
ACS Med Chem Lett
In Vitro Characterization of Agonist and Antagonist Peptide Binding Interaction Kinetics to GLP-1R in HEK293T Cells Using Surface Plasmon Resonance Microscopy. [Abstract]2026 May 4;17(5):963-972. PMID: 42157826 -
-
-
-
-
-
-
-
Solvant et solubilité
In Vitro:
0.1 M HCl : 50 mg/mL (14.90 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Protocole
-
Research Protocol for Endocrine Diseases
Endocrine diseases often arise from disrupted hormone production, hormone signaling, or target-tissue responsiveness; for diabetes-focused endocrine disease models, insulin signaling regulates glucose uptake, hepatic glucose output, lipid metabolism, and β-cell compensation. Type 2 diabetes develops through interacting defects in insulin resistance, β-cell dysfunction, adipose inflammation, hepatic glucose overproduction, altered incretin signaling, and ectopic lipid metabolism. A major unresolved question is whether endocrine dysfunction is driven primarily by target-tissue insulin resistance, intrinsic β-cell failure, immune/inflammatory stress, or combined multi-organ failure that differs by disease stage.
-
Human Islet Cell Culture
The method of preserving islets in vitro, with purified reduced immunogenicity. The steps are islet isolation, islet cell purification, in vitro determination of islet function and islet cell culture.
Pureté et documentation
-
Fiche technique (283 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Instruction de manipulation (2659 KB)
Références
[1]. Sarrauste de Menthiere, C. et al. Structural requirements of the N-terminal region of GLP-1-[7-37]-NH2 for receptor interaction and cAMP production. European journal of medicinal chemistry 39, 473-480, doi:10.1016/j.ejmech.2004.02.002 (2004). [Content Brief]
[2]. Hargrove DM, et al. Glucose-dependent action of glucagon-like peptide-1 (7-37) in vivo during short- or long-term administration. Metabolism. 1995 Sep;44(9):1231-7. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| 0.1 M HCl | 1 mM | 0.2980 mL | 1.4900 mL | 2.9800 mL | 7.4501 mL |
| 5 mM | 0.0596 mL | 0.2980 mL | 0.5960 mL | 1.4900 mL | |
| 10 mM | 0.0298 mL | 0.1490 mL | 0.2980 mL | 0.7450 mL |