Scyllatoxin
Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 142948-19-4
- Formel: C142H237N45O39S7
- Molecular Weight:3423.15
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Biologische Aktivität
For scyllatoxin, the Arg6 and Arg13 are essential for binding to the Ca2+-activated K+ channel protein and for the functional effect of the toxin[1]. For scyllatoxin, His31 is important for the binding activity of the toxin and for the induction of contractions on taenia coli[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS. Nr. 142948-19-4
-
Molecular Weight 3423.15
-
Formel C142H237N45O39S7
-
Synonyms
Leiurotoxin I
-
Sequence Shortening
AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2 (Disulfide bridge: Cys3-Cys21; Cys8-Cys26; Cys12-Cys28)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
Verweise
[1]. Auguste P, et al. Scyllatoxin, a blocker of Ca(2+)-activated K+ channels: structure-function relationships and brain localization of the binding sites. Biochemistry. 1992 Jan 28;31(3):648-54. [Content Brief]
[2]. Akiyama T, et al. Role of Ca2+-activated K+ channels in catecholamine release from in vivo rat adrenal medulla. Neurochem Int. 2010 Jan;56(2):263-9. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Scyllatoxin Related Classifications
HY-P3064 Related Classifications
Powered by Bioz