Vm24-toxin
Vm24-toxin (Vaejovis mexicanus peptide 24), a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin attenuates the CD4+ effector memory T cell response to T cell receptor (TCR) stimulation.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 1373890-79-9
- Formel: C157H253N51O45S9
- Molecular Weight:3863.59
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biologische Aktivität
Beschreibung
IC50 & Target
[1]|
Kv1.3 3 pM (Kd) |
Chemical Information
-
CAS. Nr. 1373890-79-9
-
Molecular Weight 3863.59
-
Formel C157H253N51O45S9
-
Synonyms
Vaejovis mexicanus peptide 24
-
Sequence
Ala-Ala-Ala-Ile-Ser-Cys-Val-Gly-Ser-Pro-Glu-Cys-Pro-Pro-Lys-Cys-Arg-Ala-Gln-Gly-Cys-Lys-Asn-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-Lys-Cys-Tyr-Tyr-Cys-NH2 (Disulfide bridge: Cys6-Cys26, Cys12-Cys31, Cys16-Cys33, Cys21-Cys36)
-
Sequence Shortening
AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC-NH2 (Disulfide bridge: Cys6-Cys26, Cys12-Cys31, Cys16-Cys33, Cys21-Cys36)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
Verweise
[1]. Georgina B Gurrola, et al. Structure, function, and chemical synthesis of Vaejovis mexicanus peptide 24: a novel potent blocker of Kv1.3 potassium channels of human T lymphocytes. Biochemistry. 2012, 51, 19. [Content Brief]
[2]. Veytia-Bucheli JI, et al. Kv1.3 channel blockade with the Vm24 scorpion toxin attenuates the CD4+ effector memory T cell response to TCR stimulation. Cell Commun Signal. 2018 Aug 14;16(1):45. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)