Teduglutide
Based on 2 publication(s) in Google Scholar
Teduglutide (ALX-0600) is an analog of human glucagon like peptide-2 (GLP-2). Teduglutide can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 and intestinal FXR signaling in human hepatic stellate cells, thereby improving liver inflammation and fibrosis in mice with sclerosing cholangitis. Teduglutide can alleviate intestinal dysfunction in mice, improve lung injury, alleviate obesity related neuroinflammation and cell apoptosis.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Pureté: 99.85%
- CAS No.: 197922-42-2
- Formule: C164H252N44O55S
- Masse moléculaire:3752.13
-
Stockage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
-
Solvant et solubilité
- Pureté et documentation
- Références
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) Teduglutide
MoreVoir tous les produits spécifiques à Isoform Nuclear Hormone Receptor 4A/NR4A
More
Activité biologique
|
Nur77/NR4A1 |
Teduglutide (2.5 μM, 36 h) can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 in human hepatic stellate cells[4]. Teduglutide can increase the proliferation of all intestinal segment epithelial cells and reduce cell apoptosis in the short intestine newborn piglet model[5].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:Human Hepatic Stellate Cells (HSC)
-
Concentration:2.5 μM
-
Incubation Time:36 h
-
Result:Increased transcription levels of NR4a1/Nur77.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Adult male mice undergoing 12-cm ileocecal and cecal resection (ICR)[1].
-
Dosage:0.1 mg/kg
-
Administration:Subcutaneous injection (s.c.); twice daily; 2 weeks
-
Result:Resulted in a decrease in plasma aldosterone concentration, a decrease in fecal water content, and a decrease in fecal sodium loss.
-
Animal Model:A mouse model with lung injury induced by tumor necrosis factor-alpha (TNF-α) and actinomycin D (Act D)[2].
-
Dosage:200 μg/kg
-
Administration:Subcutaneous injection (s.c.); twice daily; 10 days
-
Result:Attenuated structural damage, cell apoptosis, and oxidative stress by reducing lipid peroxidation in mice receiving TNF - α/AtD.
-
Animal Model:Mice fed a high-fat diet (HFD)[3].
-
Dosage:5 μg
-
Administration:Intraperitoneal injection (i.p.); once daily; 4 weeks
-
Result:Reduced the expression of HFD induced pro-inflammatory mediators (NF kB, IL-8, TNF - α, IL-1 β, and IL-6), glial fibrillary acidic protein (GFAP), glial proliferation and neurodegeneration index, stress marker proteins (p-ERK, Hsp60, and i-NOS), and amyloid beta precursor protein (APP).
-
Animal Model:The Mdr2/Abcb4 mouse model of sclerosing cholangitis displaying hepatic inflammation and fibrosis[4].
-
Dosage:0.05 mg/kg
-
Administration:Intraperitoneal injection (i.p.); once daily; 4 weeks
-
Result:Resulted in an increase in intrahepatic level of muricholic acids and serum Fgf15 level, as well as a decrease in mRNA levels of Cyp7a1 and FXR.
Chemical Information
-
CAS No. 197922-42-2
-
Appearance Solid
-
Masse moléculaire 3752.13
-
Formule C164H252N44O55S
-
Color White to off-white
-
Synonyms
ALX-0600
-
Sequence
His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
-
Sequence Shortening
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Nat Metab
2025 Apr;7(4):730-741. PMID: 40114026 -
Arch Gerontol Geriatr
GLP-2 ameliorates D-galactose induced muscle aging by IGF-1/Pi3k/Akt/FoxO3a signaling pathway in C2C12 cells and mice. [Abstract]2024 Sep:124:105462. PMID: 38692155
Solvant et solubilité
DMSO : 50 mg/mL (13.33 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 22.22 mg/mL (5.92 mM; ultrasonic and adjust pH to 2 with HCl)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Pureté et documentation
-
Fiche technique (290 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Références
[1]. Reiner J, et al. Teduglutide Promotes Epithelial Tight Junction Pore Function in Murine Short Bowel Syndrome to Alleviate Intestinal Insufficiency. Dig Dis Sci. 2020 Dec;65(12):3521-3537. [Content Brief]
[2]. Arda-Pirincci P, et al. Teduglutide, a glucagon-like peptide 2 analogue: a novel protective agent with anti-apoptotic and anti-oxidant properties in mice with lung injury. Peptides. 2012 Dec;38(2):238-47. [Content Brief]
[3]. Nuzzo D, et al. Glucagon-like peptide-2 reduces the obesity-associated inflammation in the brain. Neurobiol Dis. 2019 Jan;121:296-304. [Content Brief]
[4]. Fuchs CD, et al. GLP-2 Improves Hepatic Inflammation and Fibrosis in Mdr2-/- Mice Via Activation of NR4a1/Nur77 in Hepatic Stellate Cells and Intestinal FXR Signaling. Cell Mol Gastroenterol Hepatol. 2023;16(5):847-856. [Content Brief]
[5]. Naberhuis JK, et al. Teduglutide-Stimulated Intestinal Adaptation Is Complemented and Synergistically Enhanced by Partial Enteral Nutrition in a Neonatal Piglet Model of Short Bowel Syndrome. JPEN J Parenter Enteral Nutr. 2017 Jul;41(5):853-865. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O / DMSO | 1 mM | 0.2665 mL | 1.3326 mL | 2.6652 mL | 6.6629 mL |
| 5 mM | 0.0533 mL | 0.2665 mL | 0.5330 mL | 1.3326 mL | |
| DMSO | 10 mM | 0.0267 mL | 0.1333 mL | 0.2665 mL | 0.6663 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Teduglutide Related Classifications
HY-P1624 Related Classifications
Powered by Bioz