NPPB Protein, Human
Based on 1 publication(s) in Google Scholar
NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human is the recombinant human-derived BNP protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human is the recombinant human-derived BNP protein, expressed by E. coli , with tag free.
Background
TRIM5 protein serves as a capsid-specific restriction factor, impeding the infection of non-host-adapted retroviruses by blocking viral replication early in the viral life cycle, specifically after viral entry but before reverse transcription. Beyond its role as a capsid-specific restriction factor, TRIM5 also functions as a pattern recognition receptor, activating innate immune signaling in response to the retroviral capsid lattice. Upon binding to the viral capsid, TRIM5 triggers its E3 ubiquitin ligase activity, collaborating with the UBE2V1-UBE2N complex to generate 'Lys-63'-linked polyubiquitin chains. This ubiquitination process leads to the autophosphorylation of the MAP3K7/TAK1 complex, resulting in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, ultimately initiating an innate immune response in the infected cell. TRIM5's restrictive capabilities extend to various retroviruses, including N-tropic murine leukemia virus (N-MLV), equine infectious anemia virus (EIAV), simian immunodeficiency virus of macaques (SIVmac), feline immunodeficiency virus (FIV), and bovine immunodeficiency virus (BIV). Additionally, TRIM5 plays a crucial role in regulating autophagy by activating the autophagy regulator BECN1, causing its dissociation from inhibitors BCL2 and TAB2. Furthermore, TRIM5 acts as a selective autophagy receptor, recognizing and targeting HIV-1 capsid protein p24 for autophagic degradation.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P16860 (S103-H134)
-
Molecular Construction
-
N-term
-
BNP (S103-H134)
Accession # P16860 -
C-term
-
-
Protein Length
Full Length of BNP(1-30) Peptide
-
Synonyms
NPPB; PreproBNP; Natriuretic Peptide B; Iso-ANP; Brain Natriuretic Factor Prohormone; ProBNP; Natriuretic Peptide Precursor B; Brain Type Natriuretic Peptide; Gamma-Brain Natriuretic Peptide; Natriuretic Protein; Natriuretic Peptides B; BNP
-
AA Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
-
Predicted Molecular Mass
3.5 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg; determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)