Noggin Protein, Human (HEK293)
Based on 9 publication(s) in Google Scholar
Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin is a potent bone morphogenetic protein (BMP) antagonist. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency. Noggin Protein, Human (HEK293) is a recombinant Noggin protein produced by HEK293 cells.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin is a potent bone morphogenetic protein (BMP) antagonist. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency. Noggin Protein, Human (HEK293) is a recombinant Noggin protein produced by HEK293 cells.
Background
Noggin Protein belongs to the bone morphogenetic protein (BMP) antagonist family of the TGF-β superfamily. Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin Protein binds to BMP to form a neutralizing complex, preventing BMP from binding to the receptor, thereby inhibiting BMP signaling and affecting cell survival, proliferation and differentiation[1]. Noggin Protein can be expressed in human arterial endothelial cells and bone marrow mesenchymal stem cells[1]. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency[1][2][3][4][5]. Noggin Protein, Human is composed of 232 amino acids, forming a covalently linked homodimer, and has the ability to bind to BMP4 with high affinity.
In Vitro
Noggin Protein, Human (200 ng/mL; 3-21 days) induces alkaline phosphatase activity and mineralization alone or synergistically with inflammatory cytokines/Dexamethasone (HY-14648) in human mesenchymal stem cells (HMSCs), upregulating BMP-2 and ActRII gene expression[2].
In Vivo
Noggin Protein, Human (0.45-0.9 mg/kg; subcutaneous osmotic pump implantation; 4 weeks) antagonizes BMP4-induced hypertension, vascular NADPH oxidase activation, and endothelial dysfunction in C57BL/6 and apoE-/- mice[5].
Verified Bioactivity
1.Measured by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells The ED50 for this effect is <2 μg/mL in the presence of 2000 ng/mL of Recombinant Human BMP-2.
2.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is <10 ng/mL in the presence of 50 ng/mL of Recombinant Human BMP-4.
3.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is <3 ng/mL in the presence of 30 ng/mL of Recombinant Human BMP-4.
4.Measured by its ability to inhibit BMP-4 induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 10-100ng/mL in the presence of 200 ng/mL of Recombinant Human BMP 4.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (9)
-
Journal Impact Factor
-
Most Recent
-
Stem Cell Res Ther
Aucubin promotes bone-fracture healing via the dual effects of anti-oxidative damage and enhancing osteoblastogenesis of hBM-MSCs. [Abstract]2022 Aug 19;13(1):424. PMID: 35986345
Noggin Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Stem Cell Res Ther. 2022 Aug 19;13(1):424. [Abstract]
Noggin (100 ng/mL; 3 days). Phospho-Smad1/5/9, BMP2, COL1A1 and RUNX2 were quantified in hBM-MSCs after 3 days of treatment with AU and/or Noggin by western blot analysis and normalized to GAPDH and tSmad1.
-
Fundam Res
Droplet-engineered organoids recapitulate parental tissue transcriptome with inter-organoid homogeneity and inter-tumor cell heterogeneity. [Abstract]2022 Jun 3;4(6):1506-1514. PMID: 39734523 -
Sci Rep
Understanding of the different roles of Noggin in the Noggin-BMP-2 and Noggin-BMP-9 dimer complexes at the molecular level. [Abstract]2026 Jan 2;16(1):3755. PMID: 41484316 -
-
iScience
TFAP2A enhances tumor stemness and promotes metastasis in pancreatic ductal adenocarcinoma. [Abstract]2025 Jul 5;28(8):113060. PMID: 40727938 -
iScience
2025 Apr 3;28(5):112344. PMID: 40276762 -
J Cancer
Resveratrol Induces Oxidative Stress and Downregulates GPX4 and xCT to Activate the Ferroptosis Pathway for Anti-Bladder Cancer Organoids. [Abstract]2025 Jun 9;16(8):2613-2625. PMID: 40535803 -
Animals (Basel)
Effect of the TGF-β/BMP Signaling Pathway on the Proliferation of Yak Pulmonary Artery Smooth Muscle Cells under Hypoxic Conditions. [Abstract]2024 Jul 15;14(14):2072. PMID: 39061534
Noggin Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Animals (Basel). 2024 Jul 15;14(14):2072. [Abstract]
Noggin (0-250 ng/mL; 24 h). CCK8 assay of the cytotoxicity of Noggin on yak PASMCs.
Noggin Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Animals (Basel). 2024 Jul 15;14(14):2072. [Abstract]
Western blot analysis of the expression levels of BMP signaling pathway-related proteins after treatment with various concentrations of Noggin (100 and 200 ng/mL).
Noggin Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Animals (Basel). 2024 Jul 15;14(14):2072. [Abstract]
TGF-β1 (5 ng/mL; 24 h) and Noggin (100 ng/mL; 24 h) promote the migration of Yak PASMCs.
-
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
Q13253 (Q28-C232)
-
Molecular Construction
-
N-term
-
Noggin (Q28-C232)
Accession # Q13253 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
NOG; Symphalangism 1 (Proximal); Prev. SYNS1; SYNS1A; Prev. SYM1; Noggin; Synostoses (Multiple) Syndrome 1
-
AA Sequence
QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
-
Predicted Molecular Mass
23 kDa
-
Molecular Weight
Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, 2 mM EDTA, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Kang HW, et al. In vitro and In vivo imaging of antivasculogenesis induced by Noggin protein expression in human venous endothelial cells. FASEB J. 2009;23(12):4126-4134. [Content Brief]
[2]. Rifas L. The role of noggin in human mesenchymal stem cell differentiation. J Cell Biochem. 2007 Mar 1;100(4):824-34. [Content Brief]
[3]. Chaturvedi G, et al. Noggin maintains pluripotency of human embryonic stem cells grown on Matrigel. Cell Prolif. 2009 Aug;42(4):425-33. [Content Brief]
[4]. Chen C, et al. Noggin suppression decreases BMP-2-induced osteogenesis of human bone marrow-derived mesenchymal stem cells in vitro. J Cell Biochem. 2012 Dec;113(12):3672-80. [Content Brief]
[5]. Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113(24):2818-25.Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113(24):2818-25. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)