IL-5 Protein, Rat
Based on 1 publication(s) in Google Scholar
IL-5 Protein, Rat, a T-cell derived cytokine, stimulates B cell growth and increases immunoglobulin secretion.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
IL-5 Protein, Rat, a T-cell derived cytokine, stimulates B cell growth and increases immunoglobulin secretion.
Interleukin-5 (IL-5) is a T-cell derived cytokine which stimulates eosinophil production and activation in human, mice and sheep. IL-5 is active as a growth factor for mouse but not human B cells. The role of IL-5 on ruminant B cells has not been clearly defined. By hybridisation with human IL-5 cDNA, the ovine IL-5 gene is isolated from a liver genomic library. The IL-5 cDNA is obtained by reverse-transcriptase PCR using primers designed from the 5' and 3' coding sequence derived from the ovine IL-5 gene. The sequences of the cDNA shows that there is 79% and 73% nucleotide homology with the human and mouse sequences. The ovine IL-5 cDNA encodes a protein of 132 amino acids and the level of amino acid homology with human and mouse IL-5 is 64% and 56%, respectively. Two cysteine residues are conserved in ovine, human and mouse IL-5. There are two potential N-linked glycoyslation sites in ovine IL-5[1].
The ED50 is <0.4 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >2.5 × 106 units/mg.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Adv Sci (Weinh)
Eosinophils-Induced Lumican Secretion by Synovial Fibroblasts Alleviates Cartilage Degradation via the TGF-β Pathway Mediated by Anxa1 Binding. [Abstract]2025 Aug;12(29):e2416030. PMID: 40125663
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
Q08125 (M20-V132)
-
Molecular Construction
-
N-term
-
IL-5 (M20-V132)
Accession # Q08125 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL5; T-Cell Replacing Factor; Interleukin 5; EDF; Eosinophil Differentiation Factor; Colony-Stimulating Factor, Eosinophil; Interleukin-5; B-Cell Differentiation Factor I; IL-5; Interleukin 5 (Colony-Stimulating Factor, Eosinophil); TRF; B Cell Differenti
-
AA Sequence
MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under non reducing (N) conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
