Dermaseptin-S2
Dermaseptin-S2 is an antimicrobial peptide derived from frog skin against filamentous fungi.
For research use only. We do not sell to patients.
- CAS No.: 151896-13-8
- Formula: C155H255N43O43S2
- Molecular Weight:3473.08
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
Chemical Information
-
CAS No. 151896-13-8
-
Molecular Weight 3473.08
-
Formula C155H255N43O43S2
-
Sequence
Ala-Leu-Trp-Phe-Thr-Met-Leu-Lys-Lys-Leu-Gly-Thr-Met-Ala-Leu-His-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala-Ala-Ala-Asn-Thr-Ile-Ser-Gln-Gly-Thr-Gln
-
Sequence Shortening
ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Research Protocol for Infectious Diseases
Infectious-disease experiments test how pathogens interact with host barriers, innate immune receptors, inflammatory signaling, pathogen replication, and tissue injury; pattern-recognition receptors such as TLRs, RIG-I-like receptors, NOD-like receptors, and inflammasomes detect microbial molecules and activate NF-κB, interferon, and cytokine responses. The central hypothesis is that infection severity reflects the balance between pathogen burden and host response: protective inflammation restricts pathogen growth, whereas excessive or mislocalized inflammation contributes to tissue damage and disease phenotype. Unresolved questions include which host pathways are protective versus pathogenic, why some infection models fail to translate to human disease, and which combined readouts best predict clinically relevant infection outcomes.
-
Filamentous Fungal Mold Culture and Sporulation
Filamentous fungal mold culture and sporulation assays grow hyphae under defined nutritional and environmental conditions until asexual spores, commonly conidia, are produced; the main readouts are colony growth, sporulation onset, conidial yield, conidial morphology, viability, and, when relevant, downstream infectivity or stress phenotype.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)