Vosoritide
Based on 1 Customer Validation
Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research.
For research use only. We do not sell to patients.
- Purity : 99.89%
- CAS No.: 1480724-61-5
- Formula: C176H290N56O51S3
- Molecular Weight:4102.73
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Biological Activity
Description
In Vitro
Vosoritide (0.1 μM; 1 h) decreases NPR2 phosphorylation in chondrocytes[2].
Vosoritide (0.1 μM; 6 d) improves chondrocyte differentiation and increases the proliferative growth plate area of cultured Fgfr3Y367C/+ femurs[2].
Vosoritide (10 μM; overnight) reduces ERK1/2 activation in ACH growth-plate chondrocytes[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. .
-
Cell Line:Chondrocyte cultures
-
Concentration:0.1 μM
-
Incubation Time:1 hour
-
Result:Led to reduction in NPR2 phosphorylation.
-
Cell Line:Chondrocyte
-
Concentration:10 μM
-
Incubation Time:Overnight
-
Result:Prevented FGF-mediated increase in ERK1/2 phosphorylation.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Fgfr3Y367C/+ mice[3]
-
Dosage:800 μg/kg
-
Administration:Subcutaneous injection; 800 μg/kg; once daily; 20 days
-
Result:Observed phenotypic changes including flattening of the skull, elongation of the snout, improvement of the anterior crossbite, larger paws and digits, and longer and straightened tibias and femurs.
Chemical Information
-
CAS No. 1480724-61-5
-
Appearance Solid
-
Molecular Weight 4102.73
-
Formula C176H290N56O51S3
-
Color White to off-white
-
Synonyms
BMN 111
-
Sequence
Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys23-Cys39)
-
Sequence Shortening
PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys23-Cys39)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Solvent & Solubility
In Vitro:
H2O : ≥ 50 mg/mL (12.19 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (294 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Duggan S. Vosoritide: First Approval. Drugs. 2021 Nov;81(17):2057-2062. [Content Brief]
[2]. Shuhaibar LC, et al. Phosphatase inhibition by LB-100 enhances BMN-111 stimulation of bone growth. JCI Insight. 2021 May 10;6(9):e141426. [Content Brief]
[3]. Lorget F, et al. Evaluation of the therapeutic potential of a CNP analog in a Fgfr3 mouse model recapitulating achondroplasia. Am J Hum Genet. 2012 Dec 7;91(6):1108-14. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2437 mL | 1.2187 mL | 2.4374 mL | 6.0935 mL |
| 5 mM | 0.0487 mL | 0.2437 mL | 0.4875 mL | 1.2187 mL | |
| 10 mM | 0.0244 mL | 0.1219 mL | 0.2437 mL | 0.6094 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.