PNC-27 acetate
Based on 1 Customer Validation
PNC-27 acetate, a chimeric p53-penetratin peptide binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation and leads to cancer cell lysis. PNC-27 acetate is an anticancer peptide. PNC-27 acetate can be used in acute myeloid leukemia research.
For research use only. We do not sell to patients.
- Purity: 99.98%
- Formula: C188H293N53O44S.xC2H2O2
- Molecular Weight:4031.73 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
PNC-27 (50 μg/mL; 0-3 h) acetate induces cancer cell death[1].
PNC-27 (50 μg/mL; 15 min) acetate binds to cell membrane-bound HDM-2 in A2058 and MCF-7 cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:MIA-PaCa-2 cells
-
Concentration:50 μg/mL
-
Incubation Time:0-3 hours
-
Result:Induced 100% cell death in 90 min.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:MllPTD/WT/Flt3ITD/ITD AML mice[2]
-
Dosage:40 mg/kg
-
Administration:Intraperitoneal injection; 40 mg/kg; once daily; 2 or 3 weeks
-
Result:Reduced AML engraftment and prolonged survival.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4031.73 (free base)
-
Formula C188H293N53O44S.xC2H2O2
-
Color White to off-white
-
Sequence
Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly
-
Sequence Shortening
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
DMSO : 25 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Purity & Documentation
-
Data Sheet (284 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Sarafraz-Yazdi E, et al. Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes. Proc Natl Acad Sci U S A. 2010 Feb 2;107(5):1918-23. [Content Brief]
[2]. Wang H, et al. Targeting cell membrane HDM2: A novel therapeutic approach for acute myeloid leukemia. Leukemia. 2020 Jan;34(1):75-86. [Content Brief]
[3]. Ehsan Sarafraz-Yazdi, et al. PNC-27, a Chimeric p53-Penetratin Peptide Binds to HDM-2 in a p53 Peptide-like Structure, Induces Selective Membrane-Pore Formation and Leads to Cancer Cell Lysis. Biomedicines. 2022 Apr 20;10(5):945. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
PNC-27 acetate Related Classifications
HY-P3508A Related Classifications
Powered by Bioz