BCMA/TNFRSF17 Protein, Rat (HEK293, His)
BCMA/TNFRSF17 Protein, Rat (HEK293, His) is the recombinant rat-derived BCMA/TNFRSF17 protein, expressed by HEK293, with C-His tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BCMA/TNFRSF17 Protein, Rat (HEK293, His) is the recombinant rat-derived BCMA/TNFRSF17 protein, expressed by HEK293, with C-His tag.
Background
The BCMA/TNFRSF17 protein serves as a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, exerting essential functions in promoting B-cell survival and contributing to the regulation of humoral immunity. Through its activation of NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in signaling pathways associated with immune responses. Additionally, it forms associations with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, suggesting its involvement in various cellular processes mediated by these adaptor proteins.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
D3ZKQ8 (M1-T49)
-
Gene ID287034
-
Molecular Construction
-
N-term
-
BCMA (M1-T49)
Accession # D3ZKQ8 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TNFRSF17; TNFRSF13A; Prev. BCMA; Tumor Necrosis Factor Receptor Superfamily, Member 17; BCM; B Cell Maturation Antigen; Tumor Necrosis Factor Receptor Superfamily Member 17; B-Cell Maturation Factor; B-Cell Maturation Protein; CD269 Antigen; TNF Receptor
-
AA Sequence
MAQRCFHSEYFDSLLHACKPCRLRCSNPPAPCQPYCDPSMTSSVRGTYT
-
Predicted Molecular Mass
7.6 kDa
-
Molecular Weight
Approximately 10-15 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
