BPTF Protein, Human

BPTF proteins are regulatory subunits in the NURF-1 and NURF-5 ISWI chromatin remodeling complexes that assemble ordered nucleosome arrays to access DNA during replication, transcription, and repair. The NURF-1 complex is critical for brain development and actively regulates the expression of En1 and En2. BPTF Protein, Human is the recombinant human-derived BPTF protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

BPTF proteins are regulatory subunits in the NURF-1 and NURF-5 ISWI chromatin remodeling complexes that assemble ordered nucleosome arrays to access DNA during replication, transcription, and repair. The NURF-1 complex is critical for brain development and actively regulates the expression of En1 and En2. BPTF Protein, Human is the recombinant human-derived BPTF protein, expressed by E. coli , with tag free.

Background

BPTF protein functions as a regulatory subunit within the ATP-dependent NURF-1 and NURF-5 ISWI chromatin remodeling complexes, orchestrating the assembly of ordered nucleosome arrays on chromatin to facilitate DNA access during essential processes such as DNA replication, transcription, and repair. The NURF-1 ISWI chromatin remodeling complex, characterized by a lower ATP hydrolysis rate compared to NURF-5, plays a pivotal role in brain development by binding to the promoters of En1 and En2, positively regulating their expression. BPTF, as a histone-binding protein, exhibits a preference for H3 tails trimethylated on 'Lys-4' (H3K4me3), a marker for transcription start sites of active genes, and interacts with dimethylated H3 tails to a lesser extent. Beyond histone binding, BPTF may directly regulate transcription through interaction with DNA or transcription factors. It interacts with MAZ and KEAP1 and is a crucial component of the NURF-1 ISWI chromatin remodeling complex, which includes SMARCA1, BPTF, RBBP4, and RBBP7. Additionally, BPTF forms the catalytically inactive BPFT-SMARCA1 complex and is a component of the NURF-5 ISWI chromatin remodeling complex with SMARCA5/SNF2H. These interactions underscore the multifaceted role of BPTF in chromatin dynamics and transcriptional regulation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • BPTF (D2865-A3033)
      Accession # Q12830
    • C-term
  • Protein Length

    Partial

  • Synonyms

    BPTF; Nucleosome-Remodeling Factor Subunit BPTF; Prev. FALZ; Bromodomain And PHD Domain Transcription Factor; FAC1; Nucleosome Remodeling Factor, Large Subunit; Fetal Alzheimer Antigen; Fetal Alz-50 Reactive Clone 1; NURF301; BPTF Protein; Bromodomain And

  • AA Sequence

    DTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00