Copy Link Print Information

Calcitonin/CALCA Protein, Human (His)

Customer Review

Based on 1 Customer Validation

Calcitonin Protein, Human (His), is a recombinant human Calcitonin expressed in E. coli with a His tag at the C-terminus. Calcitonin has an effect on decreasing osteoclast activity and has the potential for hypercalcemia research.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Calcitonin/CALCA Protein, Human (His)
  • Experimental Validation Results for Calcitonin/CALCA Protein, Human (His)
  • Calcitonin/CALCA Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Calcitonin Protein, Human (His), is a recombinant human Calcitonin expressed in E. coli with a His tag at the C-terminus. Calcitonin has an effect on decreasing osteoclast activity and has the potential for hypercalcemia research[1].

Background

Calcitonin is a 32 amino acid hormone secreted by the C-cells of the thyroid gland. Calcitonin secretion is stimulated by increases in the serum calcium concentration and calcitonin protects against the development of hypercalcemia. Calcitonin is also stimulated by gastrointestinal hormones such as gastrin[1].

Verified Bioactivity

Measured by its ability to induce alkaline phosphatase production by MC3T3-E1 mouse chondrogenic cells. The ED50 for this effect is 0.8463 µg/mL, corresponding to a specific activity is 1181.614 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce alkaline phosphatase production by MC3T3-E1 mouse chondrogenic cells. The ED50 for this effect is 0.8463 µg/mL, corresponding to a specific activity is 1181.614 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P01258-1 (Y58-N141)

  • Gene ID
    796
  • Molecular Construction
    • N-term
    • CALCA (Y58-N141)
      Accession # P01258
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CALCA; Calcitonin 1; Prev. CALC1; CGRP1; CGRP-Alpha; Calcitonin/Calcitonin-Related Polypeptide, Alpha; Calcitonin; Katacalcin; CGRP; PCT; Calcitonin Gene-Related Peptide 1; CT; Calcitonin Gene-Related Peptide I; KC; Alpha-Type CGRP; Calcitonin Related Pol

  • AA Sequence

    YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN

  • Predicted Molecular Mass

    9.5 kDa

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.2, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce alkaline phosphatase production by MC3T3-E1 mouse chondrogenic cells. The ED50 for this effect is 0.8463 µg/mL, corresponding to a specific activity is 1181.614 units/mg.

  • Calcitonin/CALCA Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for Calcitonin/CALCA Protein, Human (His)
  • Experimental Validation Results for Calcitonin/CALCA Protein, Human (His)
  • Calcitonin/CALCA Protein, Human (His) Product Image