Cathepsin D Protein, Human (HEK293)
Cathepsin D protein is an acidic protease that actively participates in intracellular protein breakdown. Studies have shown that it is critical in the processing of amyloid precursor protein (APP), with ADAM30-mediated cleavage and activation leading to APP degradation. Cathepsin D Protein, Human (HEK293) is the recombinant human-derived Cathepsin D protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
Cathepsin D protein is an acidic protease that actively participates in intracellular protein breakdown. Studies have shown that it is critical in the processing of amyloid precursor protein (APP), with ADAM30-mediated cleavage and activation leading to APP degradation. Cathepsin D Protein, Human (HEK293) is the recombinant human-derived Cathepsin D protein, expressed by HEK293 , with tag free.
Background
Cathepsin D, an acid protease, exerts its activity in the intracellular breakdown of proteins. This protease is implicated in the processing of amyloid precursor protein (APP), with its cleavage and activation by ADAM30 leading to the degradation of APP, as evidenced in studies. Cathepsin D's involvement extends to the pathogenesis of various diseases, including breast cancer, and it is suggested to play a role in Alzheimer's disease, highlighting its significance in cellular processes and potential connections to pathological conditions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P07339 (L21-L412)
-
Gene ID1509
-
Molecular Construction
-
N-term
-
Cathepsin D (L21-L412)
Accession # P07339 -
C-term
-
-
Protein Length
Full Length of Mature Protein (with Propeptide)
-
Synonyms
CTSD; Cathepsin D (Lysosomal Aspartyl Protease); Prev. CPSD; Lysosomal Aspartyl Protease; CLN10; Cathepsin D Isoform 2; Ceroid-Lipofuscinosis, Neuronal 10; HEL-S-130P; Epididymis Secretory Sperm Binding Protein Li 130P; Cathepsin D; Lysosomal Aspartyl Pep
-
AA Sequence
LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
-
Predicted Molecular Mass
42.6 kDa
-
Molecular Weight
Approximately 43-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
N/A.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
