Cathepsin D Protein, Human (HEK293)

Cathepsin D protein is an acidic protease that actively participates in intracellular protein breakdown. Studies have shown that it is critical in the processing of amyloid precursor protein (APP), with ADAM30-mediated cleavage and activation leading to APP degradation. Cathepsin D Protein, Human (HEK293) is the recombinant human-derived Cathepsin D protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Biological Activity

Description

Cathepsin D protein is an acidic protease that actively participates in intracellular protein breakdown. Studies have shown that it is critical in the processing of amyloid precursor protein (APP), with ADAM30-mediated cleavage and activation leading to APP degradation. Cathepsin D Protein, Human (HEK293) is the recombinant human-derived Cathepsin D protein, expressed by HEK293 , with tag free.

Background

Cathepsin D, an acid protease, exerts its activity in the intracellular breakdown of proteins. This protease is implicated in the processing of amyloid precursor protein (APP), with its cleavage and activation by ADAM30 leading to the degradation of APP, as evidenced in studies. Cathepsin D's involvement extends to the pathogenesis of various diseases, including breast cancer, and it is suggested to play a role in Alzheimer's disease, highlighting its significance in cellular processes and potential connections to pathological conditions.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Cathepsin D (L21-L412)
      Accession # P07339
    • C-term
  • Protein Length

    Full Length of Mature Protein (with Propeptide)

  • Synonyms

    CTSD; Cathepsin D (Lysosomal Aspartyl Protease); Prev. CPSD; Lysosomal Aspartyl Protease; CLN10; Cathepsin D Isoform 2; Ceroid-Lipofuscinosis, Neuronal 10; HEL-S-130P; Epididymis Secretory Sperm Binding Protein Li 130P; Cathepsin D; Lysosomal Aspartyl Pep

  • AA Sequence

    LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL

  • Predicted Molecular Mass

    42.6 kDa

  • Molecular Weight

    Approximately 43-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00