1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Cathepsin L1 Protein, Mouse (HEK293, His)

Cathepsin L1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P7753
Handling Instructions

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $165 In-stock
Estimated Time of Arrival: December 31
50 μg $496 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Cathepsin L1 Protein, Mouse (HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

HEK 293

Accession

P06797 (T18-N334)

Gene ID

13039

Synonyms
rMuCathepsin L, His; Cathepsin L1; Major excreted protein; p39 cysteine proteinase; CTSL1
AA Sequence

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Weight

Approximately 30&37 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

Cathepsin L (CTSL) is a cysteine protease that belongs to the papain-like family (peptidase C1A), which is associated with tumor occurrence, development, and metastasis. Cathepsin L is implicated in invasion and metastasis of tumors, inflammatory status, atherosclerosis, renal disease, diabetes, bone diseases, viral infection and other diseases. Functions of Cathepsin L depend on their subcellular localization: Cathepsin L is involved in cell death and inflammation in the cytoplasm, and it also regulates cell cycle in the nucleus and exert degradative roles in the extracellular environment. Cathepsin L is expressed in all tissues and cell types and the primary function of cysteine cathepsins is proteolysis of protein antigens generated by pathogen endocytosis[1][2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin L1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7753
Quantity:
MCE Japan Authorized Agent: