CCL11 Protein, Rat
Based on 1 Customer Validation
CCL11 protein directly promotes eosinophil accumulation in allergic reactions, selectively affecting eosinophils without influencing other immune cells. It binds to CCR3, emphasizing its role in eosinophil-mediated processes. The interaction between CCL11 and its receptor provides insights into the regulation of allergic reactions. CCL11 Protein, Rat is the recombinant rat-derived CCL11 protein, expressed by E. coli , with tag free.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CCL11 protein directly promotes eosinophil accumulation in allergic reactions, selectively affecting eosinophils without influencing other immune cells. It binds to CCR3, emphasizing its role in eosinophil-mediated processes. The interaction between CCL11 and its receptor provides insights into the regulation of allergic reactions. CCL11 Protein, Rat is the recombinant rat-derived CCL11 protein, expressed by E. coli , with tag free.
Background
CCL11 protein, in response to the presence of allergens, plays a direct role in promoting the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Notably, CCL11 selectively influences eosinophil recruitment without a similar effect on lymphocytes, macrophages, or neutrophils. This specific activity highlights its significance in orchestrating the allergic immune response. CCL11 achieves its effects through binding to CCR3, emphasizing the involvement of this chemokine in eosinophil-mediated processes. The intricate interaction between CCL11 and its receptor sheds light on the molecular mechanisms governing the selective recruitment of immune cells during allergic reactions, providing valuable insights into the regulation of inflammatory processes.
Verified Bioactivity
1.Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 0.1-1.0 μg/mL.
2.Measured by its ability to chemoattract THP‑1 human acute monocytic leukemia cells. The ED50 for this effect is 6.052 ng/mL, corresponding to a specific activity is 1.65×105 U/mg.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
P97545 (H24-P97)
-
Molecular Construction
-
N-term
-
CCL11 (H24-P97)
Accession # P97545 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL11; Eosinophil Chemotactic Protein; Prev. SCYA11; MGC22554; Eotaxin; Small-Inducible Cytokine A11; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 11 (Eotaxin); C-C Motif Chemokine 11; Chemokine (C-C Motif) Ligand 11; C-C Motif Chemokine; C-C Mo
-
AA Sequence
HPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTKLGKEICADPKKKWVQDATKHLDQKLQTPKP
-
Predicted Molecular Mass
8.4 kDa
-
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)