CD160 Protein, Mouse (HEK293, His)

CD160 Protein, Mouse (HEK293, His) is a recombinant mouse CD160 expressed in HEK 293 cells with a His tag at the N-terminus. CD160 Protein binds weakly to MHC I and stimulates NK and CD8⁺ T‐cell activation^[1][2].

CD160, a 27 kDa glycoprotein, is a member of the immunoglobulin 'superfamily' of proteins. CD160 was initially identified with the monoclonal antibody BY55. CD160 is reported to be expressed by NK cells, NKT cells, intraepithelial T cells, γδ TCR⁺ T cells, and memory-phenotype, activated and effector CD8⁺ T cells. CD160 binds weakly to MHC I and stimulates NK and CD8⁺ T‐cell activation. CD160 also can act as a marker for cytolytic or exhausted CD8⁺ T cells^[1][2].

Mouse HVEM (HY-P71992) immobilized on CM5 Chip can bind CD160 with an affinity constant of 67.69 nM as determined in a SPR assay.

• 
  Mouse HVEM (HY-P71992) immobilized on CM5 Chip can bind CD160 with an affinity constant of 67.69 nM as determined in a SPR assay.

Mouse

HEK293

C-6*His

Q8VC80 (G28-S160)

54215  [NCBI]

Partial

GCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETSLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLS

Approximately 20-40 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Cai G, et, al. The CD160, BTLA, LIGHT/HVEM pathway: a bidirectional switch regulating T-cell activation. Immunol Rev. 2009 May;229(1):244-58.  [Content Brief]

  [2]. Kaye J. CD160 and BTLA: LIGHTs out for CD4+ T cells. Nat Immunol. 2008 Feb;9(2):122-4.  [Content Brief]