1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. TNF Superfamily Inhibitory Checkpoint Molecules Stimulatory Immune Checkpoint Molecules B Cell CD Proteins Macrophage CD Proteins Epithelial cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily
  5. HVEM
  6. HVEM/TNFRSF14 Protein, Mouse (HEK293, hFc)

HVEM (herpes virus entry mediator, TNFRSF14, CD270) is a member of the tumor necrosis factor receptor superfamily (TNFRSF). HVEM is a bidirectional molecular switch that transduces positive and negative signals. HVEM can deliver proinflammatory and survival signals when engaged by BTLA or LIGHT, stimulating lymphocyte proliferation, activation, and inducing inflammatory reactions. While, HVEM binds to CD160 and BTLA, inhibiting T- and B-lymphocyte activation and proliferation. HVEM/TNFRSF14 Protein, Mouse (HEK293, Fc) is a recombinant protein with a C-Terminal Fc label, It consists of 169 amino acids (Q39-V207) and is produced in HEK293 cells.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플 (2 μg)   Apply now
무료 샘플 (2 μg)   Apply now
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

HVEM (herpes virus entry mediator, TNFRSF14, CD270) is a member of the tumor necrosis factor receptor superfamily (TNFRSF). HVEM is a bidirectional molecular switch that transduces positive and negative signals. HVEM can deliver proinflammatory and survival signals when engaged by BTLA or LIGHT, stimulating lymphocyte proliferation, activation, and inducing inflammatory reactions. While, HVEM binds to CD160 and BTLA, inhibiting T- and B-lymphocyte activation and proliferation[2][3]. HVEM/TNFRSF14 Protein, Mouse (HEK293, Fc) is a recombinant protein with a C-Terminal Fc label, It consists of 169 amino acids (Q39-V207) and is produced in HEK293 cells.

Background

HVEM is widely expressed in a range of hematopoietic cells, including B cells, T cells, NK cells, monocytes and immature dendritic cells, and several non-hematopoietic cells and tissues, including the liver, kidney and lung[1].
The amino acid sequence of human HVEM protein has low homology for mouse HVEM protein.
HVEM is known as the “molecular switch” models of activation and inhibition. HVEM provides an inhibitory or activating signal and bi-directionally regulates host immune function. HVEM binds to LIGHT or LIGHT-α exerts a positive stimulatory effect, stimulating lymphocyte proliferation, activation, and inducing inflammatory reactions; thus, providing a second stimulatory signal for T cell activation. Besides, the Binding of HVEM to BTLA and CD160 exerts an adverse regulatory effect, promoting signal transduction through the ERK1/2 and PI3K (phosphatidylinositol 3-kinase)–AKT (protein kinase B (PKB)) pathways, leading to the production of IFNγ, inhibiting T- and B-lymphocyte activation and proliferation and binding of HVEM to HSV-gD, which can promote HSV infection in target cells[2][3].
HVEM is considered to be a molecular switch for immune responses, HVEM  induces DCs to produce IL-10 and shows protection against experimental autoimmune myocarditis (EAM) caused by myosin[4].

In Vitro

HVEM (mouse) induces DCs to produce IL-10, but not TGF-β[4].

In Vivo

HVEM (mouse, 10 µg/mouse; twice a week for the 2 weeks) shows a significant amelioration of cardiac histology in EAM mode mouse[4].

Biological Activity

1. The ED50 as determined by its ability to bind Human BTLA in functional ELISA is typically 1.17 μg/mL.
2. Measured by its ability to inhibit TNF-beta -mediated cytotoxicity using L-929 mouse fibroblast cells. The ED50 this effect is 1.688 μg/mL in the presence of 50 pg/mL of Recombinant Human TNF-beta, corresponding to a specific activity is 5.92×102 units/mg.

  • Measured by its ability to inhibit TNF-beta -mediated cytotoxicity using L-929 mouse fibroblast cells. The ED50 for this effect is 1.688 μg/mL in the presence of 50 pg/mL of Recombinant Human TNF-beta, corresponding to a specific activity is 5.92×102 units/mg.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q80WM9 (Q39-V207)

Gene ID
Molecular Construction
N-term
HVEM (Q39-V207)
Accession # Q80WM9
hFc
C-term
Protein Length

Partial

Synonyms
Tnfrsf14; hvem; Tumor necrosis factor receptor superfamily member 14; Herpes virus entry mediator A; Herpesvirus entry mediator A; HveA; Tumor necrosis factor receptor-like 2; TR2; CD antigen CD270
AA Sequence

QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV

Predicted Molecular Mass
45.6 kDa
분자량

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

HVEM/TNFRSF14 Protein, Mouse (HEK293, hFc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
HVEM/TNFRSF14 Protein, Mouse (HEK293, hFc)
Cat. No.:
HY-P71992
수량:
MCE Japan Authorized Agent: