CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, His-Avi)

The CD28 protein is critical for T cell activation, enhancing proliferation, cytokine production, and survival. When linked to TCR/CD3 and CD40L, CD28 promotes the production of IL4 and IL10, thereby regulating immune responses. CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, His-Avi) is the recombinant cynomolgus-derived CD28 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

CD28 protein plays a pivotal role in T-cell activation, promoting cell proliferation, cytokine production, and T-cell survival. Upon ligation with TCR/CD3 and CD40L costimulation, CD28 enhances the production of IL4 and IL10 in T-cells, contributing to immune response modulation. Additionally, isoform 3 of CD28 facilitates CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. The protein forms homodimers through disulfide linkages and interacts with various molecules, including DUSP14, CD80/B7-1, CD86/B7-2/B70, and GRB2. Isoform 3 specifically interacts with CD40LG, highlighting its multifaceted role in mediating immune responses and cellular signaling pathways.

Rhesus Macaque; Human; Cynomolgus

HEK293

N-Avi;N-8*His

P10747-1/Q0PDN3/Q0PDN4 (N19-P152)

940  [NCBI]/102146670/705313

Extracellular Domain

NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Approximately 36-52 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.