CIRBP Protein, Mouse (C-His)
CIRBP protein, a key player in cellular response to genotoxic stress, stabilizes survival-associated transcripts. It aids stress granule assembly, suppresses cell proliferation in the cold, and regulates translation. CIRBP interacts with EIF4G1, associates with ribosomes, and targets the 3'-UTRs of stress-responsive transcripts like RPA2 and TXN. It contributes to intricate molecular regulatory mechanisms. CIRBP, Mouse (C-His) is the recombinant mouse-derived CIRBP protein, expressed by E. coli, with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CIRBP protein, a key player in cellular response to genotoxic stress, stabilizes survival-associated transcripts. It aids stress granule assembly, suppresses cell proliferation in the cold, and regulates translation. CIRBP interacts with EIF4G1, associates with ribosomes, and targets the 3'-UTRs of stress-responsive transcripts like RPA2 and TXN. It contributes to intricate molecular regulatory mechanisms. CIRBP, Mouse (C-His) is the recombinant mouse-derived CIRBP protein, expressed by E. coli, with N-6*His labeled tag.
Background
CIRBP, the cold-inducible mRNA binding protein, emerges as a crucial component in the cellular response to genotoxic stress, exerting a protective function by stabilizing transcripts associated with cell survival. This multifaceted protein plays a pivotal role in stress granule (SG) assembly when overexpressed and is essential for the cold-induced suppression of cell proliferation. Its functional versatility includes acting as both a translational repressor and activator, with a specific affinity for the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts like RPA2 and TXN. Furthermore, CIRBP forms interactions with EIF4G1 and associates with ribosomes, underscoring its involvement in intricate regulatory mechanisms at the molecular level.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
P60824 (M1-E172)
-
Gene ID12696
-
Molecular Construction
-
N-term
-
(M1-E172)
Accession # P60824 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CIRBP; Glycine-Rich RNA Binding Protein; Cold Inducible RNA Binding Protein; A18 HnRNP; Cold-Inducible RNA-Binding Protein; Cold Inducible RNA-Binding Protein; CIRP; Testicular Tissue Protein Li 39; Glycine-Rich RNA-Binding Protein CIRP; A18HNRNP
-
AA Sequence
MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
-
Predicted Molecular Mass
25.5 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)