CLEC4C Protein, Cynomolgus (HEK293, His)
CLEC4C is a lectin-type cell surface receptor that plays a crucial role in antigen capture by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans with the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. CLEC4C Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CLEC4C protein, expressed by HEK293 , with N-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CLEC4C is a lectin-type cell surface receptor that plays a crucial role in antigen capture by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans with the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. CLEC4C Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CLEC4C protein, expressed by HEK293 , with N-His labeled tag.
Background
The CLEC4C protein functions as a lectin-type cell surface receptor and is implicated in antigen capturing by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans that contain the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. Additionally, CLEC4C binds to serum IgG and efficiently targets ligands into antigen-processing and peptide-loading compartments for presentation to T-cells. Notably, it may mediate potent inhibition of the induction of IFN-alpha/beta expression in plasmacytoid dendritic cells and act as a signaling receptor, activating protein-tyrosine kinases and mobilizing intracellular calcium. The protein forms homodimers, underscoring its potential significance in cellular signaling and immune response modulation.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-His
-
Accession
A0A2K5UWP4 (Y48-I212)
-
Molecular Construction
-
N-term
-
His
-
CLEC4C (Y48-I212)
Accession # A0A2K5UWP4 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLEC4C; Dendritic Lectin; Prev. CLECSF11; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Superfamily Member 11; Prev. CLECSF7; C-Type Lectin Domain Family 4, Member C; BDCA2; Blood Dendritic Cell Antigen 2 Protein; HECL; Blood Dendrit
-
AA Sequence
YSKTVKRLSKLQEYQQYYPSLTCVMEGKDMEDWSCCPTPWTSFQSSCYFISTVMQSWTKSQNNCSVMGADLVVINTKEEQDFITQNLKINSAYFLGLSDPKGWRHWQWVDQTPYNKNVTFWHSGEPNSPDERCAIINFRSEEWGWNDVHCHVPQKSICKMKKIYI
-
Predicted Molecular Mass
20.6 kDa
-
Molecular Weight
Approximately 28-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)