Copy Link Print Information

FRZB Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

FRZB protein is a soluble Frizzled-related protein (sFRP) that modulates Wnt signaling by directly interacting with Wnt, thereby regulating cell growth and differentiation. FRZB, also known as SFRP3, plays a key role in limb skeletogenesis as a Wnt8 signaling antagonist. FRZB Protein, Human (HEK293, His) is the recombinant human-derived FRZB protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • FRZB Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FRZB protein is a soluble Frizzled-related protein (sFRP) that modulates Wnt signaling by directly interacting with Wnt, thereby regulating cell growth and differentiation. FRZB, also known as SFRP3, plays a key role in limb skeletogenesis as a Wnt8 signaling antagonist. FRZB Protein, Human (HEK293, His) is the recombinant human-derived FRZB protein, expressed by HEK293 , with C-His labeled tag.

Background

FRZB, a soluble frizzled-related protein (sFRP), assumes a pivotal role in modulating Wnt signaling through its direct interaction with Wnts, contributing to the regulation of cell growth and differentiation in specific cell types. Particularly, FRZB, also known as SFRP3, plays a crucial part in limb skeletogenesis, functioning as an antagonist of Wnt8 signaling. Its regulatory influence extends to the precise orchestration of chondrocyte maturation and long bone development. In addition to its involvement in Wnt signaling modulation, FRZB engages in molecular interactions, exemplified by its interaction with MYOC, thereby highlighting its diverse functions and importance in cellular processes. The multifaceted regulatory role of FRZB underscores its significance in the intricate landscape of Wnt-mediated pathways and skeletogenesis.

Verified Bioactivity

Measured by its ability to inhibit proliferation of HeLa human cervical epithelial carcinoma cells. The ED50 for this effect is 0.359 μg/mL, corresponding to a specific activity is 2.786×103 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    Q92765/NP_001454.2 (A32-N325)

  • Gene ID
    2487  [NCBI]
  • Molecular Construction
    • N-term
    • FRZB (A32-N325)
      Accession # Q92765/NP_001454.2
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FRZB; FZRB; Frizzled Related Protein; HFIZ; Secreted Frizzled-Related Protein 3; Frezzled; FRZB1; SFRP-3; SFRP3; FrzB-1; FRE; Uncharacterized Protein FRZB; Frizzled-Related Protein 1; Frizzled Homolog-Related; FRZB-PEN; Frizzled-Related Protein; FRZB-1; F

  • AA Sequence

    AAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN

  • Molecular Weight

    Approximately 41 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • FRZB Protein, Human (HEK293, His) Product Image
    1/16
  • FRZB Protein, Human (HEK293, His) Product Image