Kras4B Protein, Human (G12C, His)

Customer Review

Based on 1 Customer Validation

The Kras4B protein interacts specifically with GPR31, dependent on farnesylation. This binding suggests a regulatory role for Kras4B in association with GPR31, emphasizing the importance of the farnesylation process. Comprehensive exploration into the molecular details of this interaction is crucial to understand the precise mechanisms and functional implications in cellular processes or signaling pathways. Kras4B Protein, Human (G12C, His) is the recombinant human-derived Kras4B protein, expressed by E. coli , with N-6*His labeled tag and G12C mutation.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The Kras4B protein interacts specifically with GPR31, dependent on farnesylation. This binding suggests a regulatory role for Kras4B in association with GPR31, emphasizing the importance of the farnesylation process. Comprehensive exploration into the molecular details of this interaction is crucial to understand the precise mechanisms and functional implications in cellular processes or signaling pathways. Kras4B Protein, Human (G12C, His) is the recombinant human-derived Kras4B protein, expressed by E. coli , with N-6*His labeled tag and G12C mutation.

Background

The Kras4B protein establishes a specific interaction with GPR31, and this binding is contingent on farnesylation. This interaction underscores the potential regulatory role of Kras4B in conjunction with GPR31, suggesting a dependence on the farnesylation process. Further exploration into the molecular intricacies of this interaction is essential to unravel the precise mechanisms and functional implications associated with the interplay between Kras4B and GPR31 in cellular processes or signaling pathways.

Verified Bioactivity

Measured by its ability to catalyze the substrate GTP. The specific activity is 985.97 nmol/min/mg, as measured under the described conditions.

Assay Procedure

Materials
ATPase/GTPase Assay Kit: Includes assay buffer, Reagent and Pi Standard (1 mM)
Guanosine-5'-triphosphate disodium salt (GTP, HY-W010737): Prepare a 6.67 mM GTP solution in assay buffer.
Kras4B Protein, Human (G12C, His) (HY-P70232)

Procedure
Preparation of Standard Curve
1. Dilute Pi Standard with ddH2O to concentrations of 100, 50, 30, 15, 0 µM.
2. Add 40 µL of each standard concentration to the wells.
3. Add 200 µL of Reagent to each well and incubate at room temperature (22-25°C) for 30 minutes. 4. Measure the OD value at 630 nm using a microplate reader.
5. Plot the measured OD values on the y-axis and the Pi Standard concentrations on the x-axis to obtain the standard curve equation.

Protein Activity Assay
1. Dilute GTP to 6.67 mM in assay buffer.
2. Dilute Human Kras4B protein to 10 µg/mL in assay buffer.
3. Add 20 µL of Assay Buffer to the wells of a 96-well plate, followed by 10 µL of 10 µg/mL Human Kras4B solution, 10 µL of 6.67 mM GTP solution, and 200 µL of Reagent. For blank wells, add 30 µL of assay buffer, 10 µL of 4 mM GTP solution, and 200 µL of Reagent.
4. Incubate at room temperature (22-25°C) for 30 minutes.
5. Measure the OD value at 630 nm using a microplate reader.
6. Calculate specific activity:

     Specific Activity (nmol/min/mg) =

[Pi] * (µM) x reaction volume (µL)
amount of enzyme (μg) x reaction time (min)

*Derived using calibration standard and Substrate Blank

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    KRAS; Kras-Enoph1 Fusion Protein; Prev. KRAS2; PR310 C-K-Ras Oncogene; GTPase KRas; Small Monomeric GTPase; K-Ras4B; C-Kirsten-Ras Protein; KRAS1; Proto-Oncogene GTPase; V-Ki-Ras2 Kirsten Rat Sarcoma 2 Viral Oncogene Homolog; KRAS-ENOPH Fusion; Kirsten Ra

  • AA Sequence

    MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00