IFN-gamma Protein, Human (HEK293, His-Avi)

IFN-gamma Protein is a dimeric soluble cytokine. It exerts antibacterial, antiviral and antitumor effects through JAK-STAT, mTOR, MAPK and PI3K/AKT signaling pathways. IFN-gamma Protein, Human (HEK293, His-Avi) is the recombinant human-derived IFN-gamma protein, expressed by HEK293 , with C-His, C-Avi labeled tag.

IFN-gamma is a dimeric soluble cytokine that is the only member of type II interferon IFN-gamma is produced by immune cells T cells and NK cells and plays an important role in antimicrobial, antiviral and anti-tumor responses by activating effector immune cells and enhancing antigen presentation. IFN-gamma influences gene regulation by interacting with its receptor IFNGR1 through the JAK-STAT pathway, and can also trigger mTOR, MAPK, and PI3K/AKT signaling pathways. IFN-gamma plays a role in the Class I antigen presentation pathway by inducing the substitution of the catalytic proteasome subunit for the immune proteasome subunit. IFN-gamma upregulates the MHC II complex on the cell surface by promoting the expression of several key molecules such as pepsin B/CTSB, H/CTSH, and L/CTSL. IFN-gamma is involved in the regulation of hematopoietic stem cells under developmental and homeostasis conditions by influencing the development, quiescence and differentiation of hematopoietic stem cells^{[1][2][3][4][5]}.

1. Immobilized Human IFN gamma at 2 μg/mL (100 μL/Well) on the plate. Dose response curve for Human IFNGR1 hFc with the EC₅₀ of 7.9 ng/mL determined by ELISA.
2. Immobilized Human IFN gamma, His Tag at 5 μg/mL (100 μL/well) on the plate. Dose response curve for Human IFN gamma R1, hFc Tag with the EC₅₀ of 4-6 ng/mL determined by ELISA.

Human

HEK293

C-Avi;C-8*His

P01579 (Q24-G161)

3458  [NCBI]

Full Length of Mature Protein

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

20-35 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Hisamatsu H, et al. Newly identified pair of proteasomal subunits regulated reciprocally by interferon gamma. J Exp Med. 1996 Apr 1;183(4):1807-16.  [Content Brief]

  [2]. Akiyama K, et al. Replacement of proteasome subunits X and Y by LMP7 and LMP2 induced by interferon-gamma for acquirement of the functional diversity responsible for antigen processing. FEBS Lett. 1994 Apr 18;343(1):85-8.  [Content Brief]

  [3]. Platanias LC, et al. Mechanisms of type-I- and type-II-interferon-mediated signalling. Nat Rev Immunol. 2005 May;5(5):375-86.  [Content Brief]

  [4]. Bhat MY, et al A. Comprehensive network map of interferon gamma signaling. J Cell Commun Signal. 2018 Dec;12(4):745-751.  [Content Brief]

  [5]. Lah TT, et al. Gamma-interferon causes a selective induction of the lysosomal proteases, cathepsins B and L, in macrophages. FEBS Lett. 1995 Apr 17;363(1-2):85-9.  [Content Brief]