IL-1 alpha Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-1 alpha, found in non-hematopoietic cells, connects innate and adaptive immunity. Binding to IL1R1, it activates signaling pathways involving MYD88, IRAK1, and IRAK4, leading to NF-kappa-B and MAPK pathway activation. Released during cell death, IL-1 alpha induces inflammation, senses DNA damage, and interacts with TMED10, IL1R1, and S100A13 for secretion and plasma membrane translocation. IL-1 alpha Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-1 alpha protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-1 alpha, found in non-hematopoietic cells, connects innate and adaptive immunity. Binding to IL1R1, it activates signaling pathways involving MYD88, IRAK1, and IRAK4, leading to NF-kappa-B and MAPK pathway activation. Released during cell death, IL-1 alpha induces inflammation, senses DNA damage, and interacts with TMED10, IL1R1, and S100A13 for secretion and plasma membrane translocation. IL-1 alpha Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-1 alpha protein, expressed by HEK293 , with C-His labeled tag.

Background

IL-1 alpha, a cytokine consistently present intracellularly in nearly all quiescent non-hematopoietic cells, serves a crucial role in inflammation and acts as a nexus between the innate and adaptive immune systems. Upon binding to its receptor IL1R1, accompanied by its accessory protein IL1RAP, IL-1 alpha forms the high-affinity interleukin-1 receptor complex, initiating signaling cascades that recruit adapter molecules like MYD88, IRAK1, or IRAK4. Consequently, it mediates the activation of NF-kappa-B and three MAPK pathways—p38, p42/p44, and JNK pathways. Functioning as an alarmin within the cell, IL-1 alpha is liberated into the extracellular space upon cell death, induced by disruption of the cell membrane, thereby triggering inflammation and alerting the host to injury or damage. Beyond its role as a danger signal during passive release through cell necrosis, IL-1 alpha directly senses DNA damage, acting as a signal for genotoxic stress without compromising cell integrity. Present as a monomer, IL-1 alpha interacts with TMED10, facilitating its translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) for secretion. It also interacts with IL1R1 and S100A13, the latter marking the initial step in IL-1 alpha export, followed by the direct translocation of this complex across the plasma membrane.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-1α (S113-A271)
      Accession # P79340
    • 8*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL1A; IL-1A; Prev. IL1; Preinterleukin 1 Alpha; IL1F1; Interleukin-1 Alpha; Hematopoietin-1; IL-1 Alpha; IL1-ALPHA; Interleukin 1 Alpha; Pro-Interleukin-1-Alpha

  • AA Sequence

    SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQYLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEIPKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA

  • Predicted Molecular Mass

    19.2 kDa

  • Molecular Weight

    Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00