Copy Link Print Information

IL-10 Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IL-10 protein is a major immunoregulatory cytokine with profound anti-inflammatory functions that limits excessive tissue destruction caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptors IL10RA and IL10RB, leading to JAK1- and STAT2-mediated phosphorylation of STAT3, which translocates to the nucleus and drives the expression of anti-inflammatory mediators. IL-10 Protein, Human (HEK293, His) is the recombinant human-derived IL-10 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for IL-10 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-10 Protein, Human (HEK293, His)
  • IL-10 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-10 protein is a major immunoregulatory cytokine with profound anti-inflammatory functions that limits excessive tissue destruction caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptors IL10RA and IL10RB, leading to JAK1- and STAT2-mediated phosphorylation of STAT3, which translocates to the nucleus and drives the expression of anti-inflammatory mediators. IL-10 Protein, Human (HEK293, His) is the recombinant human-derived IL-10 protein, expressed by HEK293 , with N-His labeled tag.

Background

IL-10 Protein, a key immune regulatory cytokine, exerts potent anti-inflammatory effects to prevent excessive tissue damage caused by inflammation. It engages its heterotetrameric receptor, composed of IL10RA and IL10RB, triggering JAK1 and STAT2-mediated phosphorylation of STAT3. This leads to STAT3 translocation into the nucleus, driving the expression of anti-inflammatory mediators. IL-10 Protein targets antigen-presenting cells like macrophages and monocytes, inhibiting the release of pro-inflammatory cytokines. It also hinders antigen presentation by reducing MHC-class II and co-stimulatory molecule expression, thereby dampening T cell activation. Additionally, it reprograms metabolic pathways, including mTOR signaling, to control the inflammatory response of macrophages. The protein forms homodimers and interacts with IL10RA and IL10RB.

Verified Bioactivity

1.Immobilized human IL10-His at 10 μg/mL (100 μL/well) can bind Cynomolgus IL10RA-Fc and the EC50 is 0.001-1.0 μg/mL.
2. Measured in a cell proliferation assay using MC/9-2 mouse mast cells and the ED50 is typically 1-20 ng/mL.
3. Immobilized Human IL-10 Protein at 2 μg/mL (100μL/well) can bind biotinylated Rhesus Macaque IL10RA Protein. The ED50 for this effect is 0.727 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 85%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human IL-10 Protein at 2 μg/mL (100 μL/well) can bind biotinylated Rhesus Macaque IL10RA Protein. The ED50 for this effect is 0.727 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-His
  • Accession

    P22301/NP_000563.1 (S19-N178)

  • Gene ID
    3586  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • IL-10 (S19-N178)
      Accession # P22301/NP_000563.1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL10; TGIF; Interleukin 10; T-Cell Growth Inhibitory Factor; IL-10; Interleukin-10; CSIF; Interleukin Family Protein; Cytokine Synthesis Inhibitory Factor; GVHDS; IL10A; IF2A

  • AA Sequence

    SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

  • Predicted Molecular Mass

    20.9 kDa

  • Molecular Weight

    Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
2.Supplied as a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, 0.1 M Arg, 0.02% Tween 20, pH 8.5.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 85%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Human IL-10 Protein at 2 μg/mL (100 μL/well) can bind biotinylated Rhesus Macaque IL10RA Protein. The ED50 for this effect is 0.727 μg/mL.

  • IL-10 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-10 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-10 Protein, Human (HEK293, His)
  • IL-10 Protein, Human (HEK293, His) Product Image