IL-3 Protein, Mouse (HEK293, His)
Based on 3 publication(s) in Google Scholar
IL-3 Protein, Mouse (HEK293, His) is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-3 Protein, Mouse (HEK293, His) is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure.
Background
Interleukin-3 (IL-3) is aglycoprotein belonging to the hematopoietic growth factor family that in preclinical in vitro and in vivo studies has exhibited a multilineage activity. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF)[1]. Human interleukin-3 (hIL-3) is a multipotent hematopoietic cytokine produced by mitogen and antigen-activated keratinocytes, T-lymphocytes, mast cells, NK cells, monocytes and endothelial cells. The hematopoietic progenitor cells are proliferated and differentiated with the help of hIL-3 protein into mature erythrocytes, mast cells, megakaryocytes and granulocytes. The potential use of hIL-3 protein has been extensively tested in various clinical applications such as bone marrow transplantation, hematological malignancies, cytopenias, aplastic anemia and various types of cancer[2].
Verified Bioactivity
Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is <582 pg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Int J Biol Sci
Procyanidin Suppresses Tumor Growth by Activating the B-Cell MAPK Pathway through Remodulation of the Gut Microbiota and Metabolites in Hepatocellular Carcinoma. [Abstract]2026 Jan 1;22(1):161-177. PMID: 41362739 -
Mol Ther
2025 Aug 29:S1525-0016(25)00661-6. PMID: 40886048 -
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P01586 (A27-C166)
-
Molecular Construction
-
N-term
-
IL-3 (A27-C166)
Accession # P01586 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL3; Colony-Stimulating Factor, Multiple; Interleukin 3; P-Cell Stimulating Factor; IL-3; P-Cell-Stimulating Factor; Hematopoietic Growth Factor; Mast-Cell Growth Factor; MCGF; Mast Cell Growth Factor; Multipotential Colony-Stimulating Factor; MGC79398; I
-
AA Sequence
ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
-
Predicted Molecular Mass
16.5 kDa
-
Molecular Weight
Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24(7):839-47. [Content Brief]
[2]. Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)