1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. Fibroblast Growth Factor 7 (FGF-7)
  6. KGF/FGF-7 Protein, Human (HEK293)

KGF/FGF-7 proteins coordinate embryonic development and regulate basic processes such as cell proliferation and differentiation. Its critical role extends to normal branching morphogenesis. KGF/FGF-7 Protein, Human (HEK293) is the recombinant human-derived KGF/FGF-7 protein, expressed by HEK293, with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KGF/FGF-7 proteins coordinate embryonic development and regulate basic processes such as cell proliferation and differentiation. Its critical role extends to normal branching morphogenesis. KGF/FGF-7 Protein, Human (HEK293) is the recombinant human-derived KGF/FGF-7 protein, expressed by HEK293, with tag free.

Background

KGF/FGF-7 Protein assumes a crucial role in orchestrating embryonic development, exhibiting regulatory control over fundamental processes encompassing cell proliferation and differentiation. Its essential contribution extends to the intricate realm of normal branching morphogenesis, where KGF/FGF-7 plays a pivotal role. As a growth factor specifically active on keratinocytes, it emerges as a potential major paracrine effector governing normal epithelial cell proliferation. The protein establishes key interactions, forming complexes with FGFBP1 and FGFR2, and its binding affinity with fibroblast growth factors (FGFs) and their receptors is augmented by heparan sulfate glycosaminoglycans, acting as critical coreceptors in these molecular interactions.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P21781-1 (C32-T194)

Gene ID

2252

Molecular Construction
N-term
FGF-7 (C32-T194)
Accession # P21781
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuKGF-1/FGF-7; Keratinocyte Growth Factor; Fibroblast Growth Factor-7; HBGF-7
AA Sequence

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Predicted Molecular Mass
19.0 kDa.
Molecular Weight

Approximately 24-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

KGF/FGF-7 Protein, Human (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KGF/FGF-7 Protein, Human (HEK293)
Cat. No.:
HY-P704732
Quantity:
MCE Japan Authorized Agent: