LY6G6D Protein, Human (HEK293, His)
LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (HEK293, His) is the recombinant human-derived LY6G6D protein, expressed by HEK293, with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (HEK293, His) is the recombinant human-derived LY6G6D protein, expressed by HEK293, with N-His labeled tag.
Background
LY6G6D belongs to the leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. LY6G, a small protein attached to cell surfaces via glycosylphosphatidylinositol (GPI) anchor, is used as a marker for granulocyte and myeloid suppressor cell subpopulations in mice. LY6G6D participates in the JAK-STAT5 and RAS-MEK-ERK signaling pathways. LY6G6D is a selectively expressed colorectal cancer antigen that targets therapeutic T-cell responses via T-cell adaptors[1][2][3][4].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
O95868 (N20-S104)
-
Gene ID58530
-
Molecular Construction
-
N-term
-
His
-
LY6G6D (N20-S104)
Accession # O95868 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LY6G6D; Lymphocyte Antigen 6 Complex Locus Protein G6d; Prev. C6orf23; Protein Ly6-D; MEGT1; Lymphocyte Antigen 6 Complex Locus G6D; NG25; Chromosome 6 Open Reading Frame 23; G6D; LY6G6D Protein, Isoform B; Ly6-D; Lymphocyte Antigen-6 G6D; Megakaryocyte-E
-
AA Sequence
NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
-
Predicted Molecular Mass
11.1 kDa.
-
Molecular Weight
Approximately 12-19 kDa, based on Bis-Tris PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by SDS-PAGE.
Product Properties
Lyophilized powder
<0.01 EU/μg, determined by LAL method.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
[1]. Corrales L, et al. LY6G6D is a selectively expressed colorectal cancer antigen that can be used for targeting a therapeutic T-cell response by a T-cell engager. Front Immunol. 2022 Sep 8;13:1008764. [Content Brief]
[2]. Giordano G, et al. JAK/Stat5-mediated subtype-specific lymphocyte antigen 6 complex, locus G6D (LY6G6D) expression drives mismatch repair proficient colorectal cancer. J Exp Clin Cancer Res. 2019 Jan 22;38(1):28. [Content Brief]
[3]. Loughner CL, et al. Organization, evolution and functions of the human and mouse Ly6/uPAR family genes. Hum Genomics. 2016 Apr 21;10:10. [Content Brief]
[4]. Mallya M, et al. Transcriptional analysis of a novel cluster of LY-6 family members in the human and mouse major histocompatibility complex: five genes with many splice forms. Genomics. 2002 Jul;80(1):113-23. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
