1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Mesothelin Protein, Mouse (Biotinylated, HEK293, His-Avi)

Mesothelin Protein, Mouse (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78834
Handling Instructions Technical Support

Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating cell interactions. Additionally, Megakaryocyte-potentiating factor (MPF) enhances megakaryocyte colony formation, indicating its involvement in the development of these specialized blood cell colonies. Mesothelin Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived Mesothelin protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of Mesothelin Protein, Mouse (Biotinylated, HEK293, His-Avi) is 303 a.a., with molecular weight of 45-60 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating cell interactions. Additionally, Megakaryocyte-potentiating factor (MPF) enhances megakaryocyte colony formation, indicating its involvement in the development of these specialized blood cell colonies. Mesothelin Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived Mesothelin protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of Mesothelin Protein, Mouse (Biotinylated, HEK293, His-Avi) is 303 a.a., with molecular weight of 45-60 kDa.

Background

Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating interactions between cells. Additionally, Megakaryocyte-potentiating factor (MPF) has been associated with the enhancement of megakaryocyte colony formation, indicating its involvement in processes related to the development of these specialized blood cell colonies.

Biological Activity

Immobilized Biotinylated Mouse Mesothelin His-Avi at 1 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate can bind Monoclonal Anti-Human MSLN Antibody Human IgG1 with a linear range of 10-78 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-Avi;C-His

Accession

Q61468 (D298-S600)

Gene ID
Protein Length

Partial

Conjugation

Biotin

Synonyms
MSLN; Mesothelin; MPF
AA Sequence

DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS

Molecular Weight

45-60 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4 . Normally Trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Mesothelin Protein, Mouse (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Mesothelin Protein, Mouse (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Mesothelin Protein, Mouse (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78834
Quantity:
MCE Japan Authorized Agent: