NAGA Protein, Human (HEK293, His)
NAGA proteins play a crucial role in cellular metabolism, catalyzing the removal of terminal α-N-acetylgalactosamine residues from glycolipids and glycopeptides. This enzyme activity is essential for the efficient breakdown of glycolipids, contributing to the overall catabolic process within the cell. NAGA Protein, Human (HEK293, His) is the recombinant human-derived NAGA protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NAGA proteins play a crucial role in cellular metabolism, catalyzing the removal of terminal α-N-acetylgalactosamine residues from glycolipids and glycopeptides. This enzyme activity is essential for the efficient breakdown of glycolipids, contributing to the overall catabolic process within the cell. NAGA Protein, Human (HEK293, His) is the recombinant human-derived NAGA protein, expressed by HEK293 , with C-His labeled tag.
Background
NAGA protein serves a pivotal role in cellular metabolism by catalyzing the removal of terminal alpha-N-acetylgalactosamine residues from glycolipids and glycopeptides. This enzymatic activity is essential for the efficient breakdown of glycolipids, contributing to the overall catabolic processes within the cell. NAGA's capacity to cleave these specific residues underscores its significance in regulating glycolipid degradation, reflecting its importance in maintaining cellular homeostasis and proper functioning.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P17050 (L18-Q411)
-
Molecular Construction
-
N-term
-
NAGA (L18-Q411)
Accession # P17050 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
NAGA; Alpha-NaGalase; Alpha-N-Acetylgalactosaminidase; Nagalase; Alpha-Galactosidase B; Acetylgalactosaminidase, Alpha-N- (Alpha-Galactosidase B); D22S674; GALB; N-Acetylgalactosaminidase, Alpha-
-
AA Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ
-
Molecular Weight
Approximately 46 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
