2. Recombinant Proteins
  3. Others
  4. NAGA Protein, Human (HEK293, His)

NAGA proteins play a crucial role in cellular metabolism, catalyzing the removal of terminal α-N-acetylgalactosamine residues from glycolipids and glycopeptides. This enzyme activity is essential for the efficient breakdown of glycolipids, contributing to the overall catabolic process within the cell. NAGA Protein, Human (HEK293, His) is the recombinant human-derived NAGA protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

NAGA proteins play a crucial role in cellular metabolism, catalyzing the removal of terminal α-N-acetylgalactosamine residues from glycolipids and glycopeptides. This enzyme activity is essential for the efficient breakdown of glycolipids, contributing to the overall catabolic process within the cell. NAGA Protein, Human (HEK293, His) is the recombinant human-derived NAGA protein, expressed by HEK293 , with C-His labeled tag.
Background

NAGA protein serves a pivotal role in cellular metabolism by catalyzing the removal of terminal alpha-N-acetylgalactosamine residues from glycolipids and glycopeptides. This enzymatic activity is essential for the efficient breakdown of glycolipids, contributing to the overall catabolic processes within the cell. NAGA's capacity to cleave these specific residues underscores its significance in regulating glycolipid degradation, reflecting its importance in maintaining cellular homeostasis and proper functioning.
Species

Human
Source

HEK293
Tag

C-His
Accession

P17050 (L18-Q411)
Gene ID
Molecular Construction
N-term
NAGA (L18-Q411)
Accession # P17050
His
C-term
Protein Length

Full Length of Mature Protein
Synonyms
Alpha-N-acetylgalactosaminidase; Alpha-galactosidase B; NAGA
AA Sequence

LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ

분자량

Approximately 47-65 kDa due to the glycosylation.
Purity

≥ 95%, as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
각종 서류
SDS (251 KB) Handling Instructions (2659 KB)

NAGA Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

NAGA Protein, Human (HEK293, His)

  

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

도

Country or Region *

      

비고

대량구매 문의

Inquiry Information

상품명:
NAGA Protein, Human (HEK293, His)
Cat. No.:
HY-P73753
수량:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

상품명

  

Lot #

고객명 *

 

Country or Region *

메일주소 *

     

전화번호 *

 

회사명 *

비고

SAFETY DATA SHEET (SDS)

English - EN (251 KB) Français - FR (251 KB) Deutsch - DE (251 KB) Norwegian - NO (251 KB) Español - ES (251 KB) Swedish - SV (251 KB) Italian - IT (251 KB) Korean - KR (251 KB) Portuguese - PT (251 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.