1. Protéines recombinantes
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Prostasin/PRSS8 Protein, Human (HEK293, His)

Prostasin/PRSS8, with trypsin-like cleavage specificity, crucially activates the epithelial sodium channel (ENaC) by cleaving its gamma subunits (SCNN1G). This protein forms a heterodimeric complex, consisting of light and heavy chains connected by a disulfide bond. Prostasin/PRSS8 Protein, Human (HEK293, His) is the recombinant human-derived Prostasin/PRSS8 protein, expressed by HEK293 , with C-His labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
Échantillon gratuit   Apply now
Échantillon gratuit   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products
  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

Prostasin/PRSS8, with trypsin-like cleavage specificity, crucially activates the epithelial sodium channel (ENaC) by cleaving its gamma subunits (SCNN1G). This protein forms a heterodimeric complex, consisting of light and heavy chains connected by a disulfide bond. Prostasin/PRSS8 Protein, Human (HEK293, His) is the recombinant human-derived Prostasin/PRSS8 protein, expressed by HEK293 , with C-His labeled tag.

Background

Prostasin/PRSS8 protein exhibits trypsin-like cleavage specificity, with a particular affinity for poly-basic substrates. It plays a crucial role in stimulating the activity of the epithelial sodium channel (ENaC) by activating the cleavage of its gamma subunits (SCNN1G). Structurally, it is composed of two chains, a light and a heavy chain, which are held together by a disulfide bond, forming a heterodimeric complex.

Activité biologique

Measured by its ability to cleave the fluorogenic peptide substrate Boc-QAR-AMC. The specific activity is 121.6525 pmol/min/µg, as measured under the described conditions.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q16651 (A30-R322)

Gene ID
Molecular Construction
N-term
Prostasin (A30-R322)
Accession # Q16651
His
C-term
Protein Length

Partial

Synonyms
Channel-activating protease 1; CAP1; Serine protease 8
AA Sequence

AEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLR

Masse moléculaire

Approximately 40 kDa

Glycosylation
Yes
Pureté
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Documentation

Prostasin/PRSS8 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

Prostasin/PRSS8 Protein, Human (HEK293, His)

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
Prostasin/PRSS8 Protein, Human (HEK293, His)
Cat. No.:
HY-P77153
Quantité:
MCE Japan Authorized Agent: