Prostasin/PRSS8 Protein, Human (HEK293, His)
Based on 1 Customer Validation
Prostasin/PRSS8, with trypsin-like cleavage specificity, crucially activates the epithelial sodium channel (ENaC) by cleaving its gamma subunits (SCNN1G). This protein forms a heterodimeric complex, consisting of light and heavy chains connected by a disulfide bond. Prostasin/PRSS8 Protein, Human (HEK293, His) is the recombinant human-derived Prostasin/PRSS8 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Prostasin/PRSS8, with trypsin-like cleavage specificity, crucially activates the epithelial sodium channel (ENaC) by cleaving its gamma subunits (SCNN1G). This protein forms a heterodimeric complex, consisting of light and heavy chains connected by a disulfide bond. Prostasin/PRSS8 Protein, Human (HEK293, His) is the recombinant human-derived Prostasin/PRSS8 protein, expressed by HEK293 , with C-His labeled tag.
Background
Prostasin/PRSS8 protein exhibits trypsin-like cleavage specificity, with a particular affinity for poly-basic substrates. It plays a crucial role in stimulating the activity of the epithelial sodium channel (ENaC) by activating the cleavage of its gamma subunits (SCNN1G). Structurally, it is composed of two chains, a light and a heavy chain, which are held together by a disulfide bond, forming a heterodimeric complex.
Verified Bioactivity
Measured by its ability to cleave the fluorogenic peptide substrate Boc-QAR-AMC. The specific activity is 121.6525 pmol/min/µg, as measured under the described conditions.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q16651 (A30-R322)
-
Molecular Construction
-
N-term
-
Prostasin (A30-R322)
Accession # Q16651 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
PRSS8; Channel-Activating Serine Protease 1; Serine Protease 8; Channel-Activating Protease 1; CAP1; Protease, Serine 8; Prostasin
-
AA Sequence
AEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLR
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
