RBM14 Protein, Human (His-SUMO)
Based on 1 Customer Validation
The RBM14 protein has different isoforms with multiple functions. Isoform 1 enhances transcription as a nuclear receptor coactivator, interacting with NCOA6 and CITED1. RBM14 Protein, Human (His-SUMO) is the recombinant human-derived RBM14 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The RBM14 protein has different isoforms with multiple functions. Isoform 1 enhances transcription as a nuclear receptor coactivator, interacting with NCOA6 and CITED1. RBM14 Protein, Human (His-SUMO) is the recombinant human-derived RBM14 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Background
RBM14 protein exhibits diverse functional roles depending on its isoform. Isoform 1 acts as a nuclear receptor coactivator, enhancing transcription through interactions with coactivators such as NCOA6 and CITED1. In contrast, Isoform 2 functions as a transcriptional repressor, modulating the activities of coactivators, including Isoform 1, NCOA6, and CITED1. Notably, RBM14 is implicated in the regulation of centriole biogenesis, where it suppresses the formation of aberrant centriolar protein complexes, ensuring the integrity of the mitotic spindle. Additionally, RBM14 plays a crucial role in the DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, serving as a platform for IRF3 phosphorylation and activating the innate immune response through the cGAS-STING pathway. Interactions with various proteins, including NCOA6, CITED1, XRCC5/KU86, SS18 isoforms, STIL, and gamma-tubulin, underscore its involvement in multiple cellular processes and signaling pathways. Furthermore, RBM14's incorporation into the HDP-RNP complex highlights its role in orchestrating innate immune responses against DNA viruses.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
Q96PK6 (M1-M669)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
RBM14 (M1-M669)
Accession # Q96PK6 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RBM14; SYT-Interacting Protein; RNA Binding Motif Protein 14; Paraspeckle Protein 2; SIP; DKFZp779J0927; RNA-Binding Protein 14; PSP2; SYTIP1; Transmembrane Protein 137; COAA; SYT Interacting Protein; RRM-Containing Coactivator Activator/Modulator; Coacti
-
AA Sequence
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQQAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASMGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM
-
Predicted Molecular Mass
85.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6%
trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)