SF20/MYDGF Protein, Mouse

Customer Review

Based on 1 Customer Validation

SF20/MYDGF protein promotes cardiac myocyte survival and adaptive angiogenesis after myocardial infarction (MI). It stimulates endothelial cell proliferation via MAPK1/3, STAT3, and CCND1 signaling, and inhibits cardiac myocyte apoptosis through PI3K/AKT signaling. Given its ability to enhance cardiac function and angiogenesis, SF20/MYDGF protein could be a valuable therapeutic target for improving outcomes in MI patients. SF20/MYDGF Protein, Mouse is the recombinant mouse-derived SF20/MYDGF, expressed by E. coli, with tag-free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SF20/MYDGF protein promotes cardiac myocyte survival and adaptive angiogenesis after myocardial infarction (MI). It stimulates endothelial cell proliferation via MAPK1/3, STAT3, and CCND1 signaling, and inhibits cardiac myocyte apoptosis through PI3K/AKT signaling. Given its ability to enhance cardiac function and angiogenesis, SF20/MYDGF protein could be a valuable therapeutic target for improving outcomes in MI patients. SF20/MYDGF Protein, Mouse is the recombinant mouse-derived SF20/MYDGF, expressed by E. coli, with tag-free.

Background

SF20/MYDGF protein is a bone marrow-derived monocyte and paracrine-acting protein that plays a crucial role in promoting cardiac myocyte survival and adaptive angiogenesis for cardiac protection and repair following myocardial infarction (MI). It exerts its effects by stimulating endothelial cell proliferation through a signaling pathway involving MAPK1/3, STAT3, and CCND1. Additionally, SF20/MYDGF protein inhibits cardiac myocyte apoptosis through a signaling pathway dependent on PI3K/AKT. This protein's ability to enhance cardiac function and promote angiogenesis makes it a potential therapeutic target for treating MI and improving cardiac outcomes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Mouse SF20 is used at 2 μg/mL can bind Recombinant Human P4HB. The ED50 for this effect is 0.681 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Mouse SF20 is used at 2 μg/mL can bind Recombinant Human P4HB. The ED50 for this effect is 0.681 μg/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SF20 (V25-L166)
      Accession # Q9CPT4
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    MYDGF; Myeloid-Derived Growth Factor; Prev. C19orf10; IL-25; Prev. IL27w; Stromal Cell-Derived Growth Factor SF20; Prev. IL27; Chromosome 19 Open Reading Frame 10; R33729_1; UPF0556 Protein C19orf10; SF20; EUROIMAGE1875335; IL25; Interleukin-25; Interleuk

  • AA Sequence

    VSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00