SF20/MYDGF Protein, Mouse
Based on 1 Customer Validation
SF20/MYDGF protein promotes cardiac myocyte survival and adaptive angiogenesis after myocardial infarction (MI). It stimulates endothelial cell proliferation via MAPK1/3, STAT3, and CCND1 signaling, and inhibits cardiac myocyte apoptosis through PI3K/AKT signaling. Given its ability to enhance cardiac function and angiogenesis, SF20/MYDGF protein could be a valuable therapeutic target for improving outcomes in MI patients. SF20/MYDGF Protein, Mouse is the recombinant mouse-derived SF20/MYDGF, expressed by E. coli, with tag-free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
SF20/MYDGF protein promotes cardiac myocyte survival and adaptive angiogenesis after myocardial infarction (MI). It stimulates endothelial cell proliferation via MAPK1/3, STAT3, and CCND1 signaling, and inhibits cardiac myocyte apoptosis through PI3K/AKT signaling. Given its ability to enhance cardiac function and angiogenesis, SF20/MYDGF protein could be a valuable therapeutic target for improving outcomes in MI patients. SF20/MYDGF Protein, Mouse is the recombinant mouse-derived SF20/MYDGF, expressed by E. coli, with tag-free.
SF20/MYDGF protein is a bone marrow-derived monocyte and paracrine-acting protein that plays a crucial role in promoting cardiac myocyte survival and adaptive angiogenesis for cardiac protection and repair following myocardial infarction (MI). It exerts its effects by stimulating endothelial cell proliferation through a signaling pathway involving MAPK1/3, STAT3, and CCND1. Additionally, SF20/MYDGF protein inhibits cardiac myocyte apoptosis through a signaling pathway dependent on PI3K/AKT. This protein's ability to enhance cardiac function and promote angiogenesis makes it a potential therapeutic target for treating MI and improving cardiac outcomes.
Measured by its binding ability in a functional ELISA. When Recombinant Mouse SF20 is used at 2 μg/mL can bind Recombinant Human P4HB. The ED50 for this effect is 0.681 μg/mL.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9CPT4 (V25-L166)
-
Molecular Construction
-
N-term
-
SF20 (V25-L166)
Accession # Q9CPT4 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
MYDGF; Myeloid-Derived Growth Factor; Prev. C19orf10; IL-25; Prev. IL27w; Stromal Cell-Derived Growth Factor SF20; Prev. IL27; Chromosome 19 Open Reading Frame 10; R33729_1; UPF0556 Protein C19orf10; SF20; EUROIMAGE1875335; IL25; Interleukin-25; Interleuk
-
AA Sequence
VSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
