SMO Protein, Human (sf9, Flag, His)

SMO Protein, Human (sf9, Flag, His) is the recombinant human-derived SMO, expressed by sf9 insect cells , with His, Flag labeled tag. ,

SMO is a G protein-coupled receptor that associates with the patched protein (PTCH) to transduce hedgehog protein signaling. Binding of sonic hedgehog (SHH) to its receptor patched prevents inhibition of smoothened (SMO) by patched. When active, SMO binds to and sequesters protein kinase A catalytic subunit PRKACA at the cell membrane, preventing PRKACA-mediated phosphorylation of GLI transcription factors, which releases the GLI proteins and allows transcriptional activation of hedgehog pathway target genes (By similarity). SMO is also required for the accumulation of KIF7, GLI2, and GLI3 in the cilia (PubMed:19592253) and interacts with DLG5 at the ciliary base to induce the accumulation of KIF7 and GLI2 at the ciliary tip for GLI2 activation (By similarity).

Human

Sf9 insect cells

His;Flag

Q99835 (S190-Q555)

6608

Partial

SGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQ

≥ 80%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. /biology-dictionary/hct-116-cell.html  [Content Brief]