SMO Protein, Human (sf9, Flag, His)
SMO Protein, Human (sf9, Flag, His) is the recombinant human-derived SMO, expressed by sf9 insect cells , with His, Flag labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SMO Protein, Human (sf9, Flag, His) is the recombinant human-derived SMO, expressed by sf9 insect cells , with His, Flag labeled tag. ,
Background
SMO is a G protein-coupled receptor that associates with the patched protein (PTCH) to transduce hedgehog protein signaling. Binding of sonic hedgehog (SHH) to its receptor patched prevents inhibition of smoothened (SMO) by patched. When active, SMO binds to and sequesters protein kinase A catalytic subunit PRKACA at the cell membrane, preventing PRKACA-mediated phosphorylation of GLI transcription factors, which releases the GLI proteins and allows transcriptional activation of hedgehog pathway target genes (By similarity). SMO is also required for the accumulation of KIF7, GLI2, and GLI3 in the cilia (PubMed:19592253) and interacts with DLG5 at the ciliary base to induce the accumulation of KIF7 and GLI2 at the ciliary tip for GLI2 activation (By similarity).
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag His;Flag
-
Accession
Q99835 (S190-Q555)
-
Gene ID6608
-
Protein Length
Partial
-
Synonyms
SMO; Seven Transmembrane Helix Receptor; Prev. SMOH; Smoothened (Drosophila) Homolog; FZD11; Smoothened Homolog (Drosophila); Smoothened, Seven Transmembrane Spanning Receptor; Smoothened Homolog; Smoothened, Frizzled Family Receptor; CRJS; Frizzled Famil
-
AA Sequence
SGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQ
-
Predicted Molecular Mass
56.1 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
