SULT1A1 Protein, Human (His)
Based on 1 Customer Validation
SULT1A1 Protein, Human (His) is the recombinant human-derived SULT1A1 protein, expressed by E. coli, with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
SULT1A1 Protein, Human (His) is the recombinant human-derived SULT1A1 protein, expressed by E. coli, with N-6*His labeled tag.
Background
SULT1A1 is a sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as a sulfonate donor to catalyze the sulfate conjugation of various hydroxyl- or amine-bearing acceptor molecules. Sulfonation enhances water solubility (facilitating renal excretion) but may also bioactivate compounds. It exhibits broad substrate specificity for small phenolic compounds and plays key roles in sulfating endogenous molecules including steroid hormones, dopamine, and thyroid hormones (T4/T3/rT3/3,3'-T2 with preference for 3,3'-T2). This enzyme mediates xenobiotic sulfation (e.g. drugs acetaminophen and minoxidil, by similarity) and metabolic activation of carcinogenic N-hydroxyarylamines into DNA-adduct-forming intermediates. Recent findings suggest its involvement in gut microbiota-host interactions through O-sulfonation of bacterial metabolite 4-ethylphenol (4-EP), which may cross the blood-brain barrier and modulate oligodendrocyte maturation, potentially affecting limbic system connectivity.
Verified Bioactivity
Measured by its ability to transfer sulfate from PAPS to 1-Napthol. The specific activity is 56.4 pmol/min/μg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Assay Procedure
Materials
Test protein: SULT1A1 Protein, Human (His) (HY-P70969)
1-Naphthol, 10 mM in ethanol
3'-Phosphoadenosine-5'-phosphosulfate (PAPS)
Universal Sulfotransferase Activity Kit, containing Assay Buffer (50 mM Tris, 15 mM MgCl2, pH 7.5)
Procedure
1. Dilute the 10× buffer from the kit to 1× buffer.
2. Dilute the phosphate standard to concentrations of 5000, 2500, 1250, 625, 313, 156, 78, and 0 pmol.
3. Prepare a reaction mixture containing 0.4 mM PAPS, 0.4 mM 1-naphthol, and 0.02 mg/mL coupled phosphatase 3 using 1× buffer.
4. Dilute the test protein to 20 μg/mL with 1× buffer.
5. Add 50 μL of the standard curve dilutions to each well of a 96-well plate, and add 50 μL of 1× buffer to the blank wells.
6. Add 25 μL of Human SULT1A1 to the appropriate wells, and add 25 μL of 1× buffer to the blank wells.
7. Add 25 μL of the reaction mixture to all wells except those used for the standard curve.
8. Seal the plate and incubate at 37 °C for 20 minutes.
9. Add 30 μL of Malachite Green Reagent A to all wells and mix.
10. Add 100 μL of deionized water to all wells and mix.
11. Add 30 μL of Malachite Green Reagent B to all wells, mix, and incubate at room temperature for 20 minutes.
12. Read the absorbance at 620 nm using a microplate reader.
13. Calculate the specific activity:
Specific Activity (nmol/min/μg) = | Phosphate released* (nmol) × 1000 pmoL/nmoL |
| Incubation time (min) × amount of enzyme (μg) |
*Derived from the phosphate standard curve and adjusted for Control.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
AAH00923.1 (M1-L295)
-
Molecular Construction
-
N-term
-
6*His
-
SULT1A1 (M1-L295)
Accession # AAH00923.1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SULT1A1; P-PST 1; Prev. STP1; ST1A1; Prev. STP; ST1A3; P-PST; Thermostable Phenol Sulfotransferase1; Sulfotransferase Family, Cytosolic, 1A, Phenol-Preferring, Member 1; Thermostable Phenol Sulfotransferase; Phenol-Sulfating Phenol Sulfotransferase 1; Phe
-
AA Sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
-
Predicted Molecular Mass
35.6 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
1.Supplied as a 0.22 μm filtered solution of 20 mM PB, 10% trehalose, 50 mM NaCl, 0.05% Tweem 80, pH 7.8.
2.Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0, 2 mM DTT.
3.Supplied as a 0.22 μm filtered solution of 50 mM PB, 50 mM NaCl, pH 7.8, 10% glycerol, 10% trehalose, 0.05% Tween 80.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)