SULT1A1 Protein, Human (His)

For research use only. We do not sell to patients.

Size	Price	Stock	Quantity
10 μg	$170	In-stock	Estimated Time of Arrival: December 31
50 μg	$510	In-stock	Estimated Time of Arrival: December 31
100 μg		Get quote

* Please select Quantity before adding items.

Biological Activity	The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Species	Human
Source	E. coli
Tag	N-6*His
Accession	AAH00923.1 (M1-L295)
Gene ID	6817 [NCBI]
Molecular Construction	N-term 6*His SULT1A1 (M1-L295) Accession # AAH00923.1 C-term
Synonyms	Sulfotransferase 1A1; ST1A1; Aryl sulfotransferase 1; HAST1/HAST2; Phenol Sulfotransferase 1; Phenol-Sulfating Phenol Sulfotransferase 1; P-PST 1; ST1A3; Thermostable Phenol Sulfotransferase; Ts-PST; SULT1A1; STP; STP1; OK/SW-cl.88
AA Sequence	MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Molecular Weight	Approximately 32.0 kDa
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Appearance	Solution
Formulation	Supplied as a 0.2 μm filtered solution of 20 mM PB, 10% Trehalose, 50 mM Nacl, 0.05% Tween 80, pH 7.8.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Storage & Stability	Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping	Shipping with dry ice.
Documentation	Select Batch: Data Sheet (233 KB) SDS (251 KB) COA (219 KB) Handling Instructions (2659 KB)

SULT1A1 Protein, Human (His) Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.