UBE2D4 Protein, Human (GST)
The UBE2D4 protein is an important ubiquitin-proteasome system component that acts as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to proteins. In vitro, UBE2D4 exhibits multifunctionality by promoting polyubiquitination of all seven ubiquitin Lys residues, possibly favoring polyubiquitination of “Lys-11” and “Lys-48” linkages. UBE2D4 Protein, Human (GST) is the recombinant human-derived UBE2D4 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The UBE2D4 protein is an important ubiquitin-proteasome system component that acts as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to proteins. In vitro, UBE2D4 exhibits multifunctionality by promoting polyubiquitination of all seven ubiquitin Lys residues, possibly favoring polyubiquitination of “Lys-11” and “Lys-48” linkages. UBE2D4 Protein, Human (GST) is the recombinant human-derived UBE2D4 protein, expressed by E. coli , with N-GST labeled tag.
UBE2D4, a crucial component of the ubiquitin-proteasome system, operates as an E2 ubiquitin-conjugating enzyme by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to other proteins. In vitro, UBE2D4 showcases its versatility by demonstrating the ability to promote polyubiquitination using all seven ubiquitin Lys residues, with a potential preference for 'Lys-11' and 'Lys-48'-linked polyubiquitination. This dynamic range of ubiquitin chain linkages suggests UBE2D4's involvement in diverse cellular processes and regulatory pathways, emphasizing its significance in the intricate network of protein degradation and turnover.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q9Y2X8 (M1-M147)
-
Gene ID51619 [NCBI]
-
Molecular Construction
-
N-term
-
GST
-
UBE2D4 (M1-M147)
Accession # Q9Y2X8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2D4; Ubiquitin Conjugating Enzyme E2 D4; HBUCE1; Ubiquitin‑Conjugating Enzyme E2 D4; E2 Ubiquitin‑Conjugating Enzyme D4; Ubiquitin Carrier Protein D4; Ubiquitin‑Protein Ligase D4; Ubiquitin‑Conjugating Enzyme E2D 4 (Putative); Ubiquitin Conjugating Enz
-
AA Sequence
MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM
-
Predicted Molecular Mass
43.5 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
