VSIG1 Protein, Human (HEK293, His)
VSIG1 Protein is a member of the adhesion molecule (JAM) family and is expressed in the normal stomach and testes, as well as in cancers of the stomach, esophagus, and ovary. VSIG1 Protein mediates the activation of Wnt/尾-catenin signaling pathway, which has tumor inhibition function and reduces the proliferation and migration ability of tumor cells. VSIG1 Protein, Human (HEK293, His) is the recombinant human-derived VSIG1 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
VSIG1 Protein is a member of the adhesion molecule (JAM) family and is expressed in the normal stomach and testes, as well as in cancers of the stomach, esophagus, and ovary. VSIG1 Protein mediates the activation of Wnt/尾-catenin signaling pathway, which has tumor inhibition function and reduces the proliferation and migration ability of tumor cells. VSIG1 Protein, Human (HEK293, His) is the recombinant human-derived VSIG1 protein, expressed by HEK293 , with N-His labeled tag.
Background
VSIG1 is a member of the adhesion molecule (JAM) family and is expressed in the normal stomach and testicles, as well as in cancers of the stomach, esophagus, and ovary. VSIG1 mediates activation of Wnt/β-catenin signaling pathway as a new target for epithelial-mesenchymal transformation in gastric cancer. VSIG1 has a tumor suppressor function, reducing the proliferation and migration ability of tumor cells[1][2][3][4][5].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
Q86XK7-1 (V22-E232)
-
Molecular Construction
-
N-term
-
His
-
VSIG1 (V22-E232)
Accession # Q86XK7-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
VSIG1; V-Set And Immunoglobulin Domain Containing 1; GPA34; Glycoprotein A34; V-Set And Immunoglobulin Domain-Containing Protein 1; Cell Surface A33 Antigen; MGC44287; 1700062D20Rik; DJ889N15.1
-
AA Sequence
VQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSHPE
-
Predicted Molecular Mass
26.4 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
