ZBTB7A Protein, Human (His)
ZBTB7A Protein, Human (His) is the recombinant human-derived ZBTB7A, expressed by E. coli , with His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
ZBTB7A Protein, Human (His) is the recombinant human-derived ZBTB7A, expressed by E. coli , with His labeled tag. ,
ZBTB7A is a transcription factor that represses genes involved in cell proliferation and differentiation by binding to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'. It modulates chromatin organization and recruits transcriptional regulators (e.g., HDAC1 to SMAD4-DNA complexes while blocking CREBBP/EP300 in TGF-β signaling). It interacts with factors like RELA (by similarity) and SP1 to inhibit DNA binding, acts as an AR corepressor via NCOR1/NCOR2 recruitment, and regulates fetal-to-adult globin switching via the NuRD complex. It controls glycolysis, adipogenesis (by similarity), and B/T lymphoid lineage differentiation by suppressing Notch targets (by similarity). Beyond transcription, it may participate in cNHEJ-mediated DNA repair and modulate KHDRBS1 splicing activity toward BCL2L1.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag His
-
Accession
O95365 (M1-I149)
-
Gene ID51341
-
Protein Length
Partial
-
Synonyms
ZBTB7A; Zinc Finger And BTB Domain Containing 7A; ZBTB7; Pokemon; ZNF857A; FBI‑1; LRF; POK Erythroid Myeloid Ontogenic Factor; Zinc Finger And BTB Domain Containing 7A, HIV‑1 Inducer Of Short Transcripts Binding Protein; Factor That Binds To Inducer Of Sh
-
AA Sequence
MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSHVCADLLDRQILAADAGADAGQLDLVDQI
-
Predicted Molecular Mass
19.7 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)